WO2007110205A2 - Engineered heterodimeric protein domains - Google Patents
Engineered heterodimeric protein domains Download PDFInfo
- Publication number
- WO2007110205A2 WO2007110205A2 PCT/EP2007/002590 EP2007002590W WO2007110205A2 WO 2007110205 A2 WO2007110205 A2 WO 2007110205A2 EP 2007002590 W EP2007002590 W EP 2007002590W WO 2007110205 A2 WO2007110205 A2 WO 2007110205A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- domains
- domain
- protein
- engineered
- seed
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
- C07K16/246—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- the invention relates to engineered heterodimeric protein domains and methods of making the same.
- BsAbs capable of binding to at least two different antigens have significant potential in a wide range of clinical applications as targeting agents for in vitro and in vivo immunodiagnosis and therapy, and for diagnostic immunoassays.
- BsAbs have been very useful in probing the functional properties of cell surface molecules and in defining the ability of the different Fc receptors to mediate cytotoxicity (Fanger et al. (1992) Crit. Rev. Immunol. 12:101-124, the teachings of which are hereby incorporated by reference.)
- BsAbs are generated simply by co- expression of multiple components that can interact without specificity, a large number of species are often generated, and it is often difficult to separate the desired species from the undesired species. Therefore, it is desirable to have techniques for efficiently making heteromultimers. It is particularly desirable to generate antibody subunits that form heterodimers preferentially over forming homodimers so that BsAbs can be directly recovered from recombinant cell culture.
- the present invention provides a novel approach for designing protein domains that preferentially heterodimerize or heteromultimerize.
- the invention uses a "Strand Exchange Engineered Domain” (SEED) strategy to engineer a protein-protein interaction interface that promotes heterodimerization or heteromultimerization.
- SEED Simple Exchange Engineered Domain
- the invention also provides proteins containing domains engineered using the method of the present invention.
- the present invention features a multidomain protein including at least first and second nonidentical engineered domains, each of which contains a protein-protein interaction interface containing amino acid sequence segments derived from two or more naturally-occurring homologous parent domains, thereby conferring on the first and second engineered domains assembly specificities distinct from assembly specificities of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers (e.g. , the heterodimers constitute more than 55%, 65%, 75%, 80%, 85%, 90%, or 95% of the total amount of dimers).
- the first and second engineered domains are not antibody variable domains.
- the multidomain protein of the invention includes a first subunit containing the first engineered domain and a second subunit containing the second engineered domain.
- an "amino acid sequence segment” includes any sequence segment containing two or more amino acids (e.g., three or more, four or more, five or more, six or more, seven or more, eight or more nine or more, or ten or more).
- the multidomain protein includes nonidentical domains engineered from naturally-occurring homologous parent domains that are immunoglobulin superfamily domains, such as, for example, antibody CH3 domains.
- the engineered domains are derived from IgG and IgA CH3 domains.
- the multidomain protein of the invention includes engineered domains that are part of polypeptide chains that are connected by a disulfide bond.
- one of the engineered domains contained in the multidomain protein of the invention includes at least two non- adjacent sequence segments derived from the same parent domain.
- each of the first and second engineered domains includes at least two, three, or four or more non-adjacent sequence segments derived from the same parent domain.
- at least one of the engineered domains includes sequence segments from each parent domain that are at least two amino acids in length.
- at least one of the engineered domains includes sequence segments from each parent domain that are at least three, four, five or six amino acids in length.
- the multidomain protein of the invention includes a first bio-active domain.
- the first bio-active domain may occupy a position N-terminal or C-terminal to the first engineered domain.
- the multidomain protein may further include a second bio-active domain in addition to the first bio-active domain.
- the second bio-active domain is associated with the second engineered domain and may occupy a position N-terminal or C-terminal to the second engineered domain, hi an alternate embodiment, the second bio-active domain is also associated with the first engineered domain and may occupy a position opposite the first bio-active domain.
- the first and second bio-active domains may occupy positions N-terminal and C- terminal, respectively, to the first engineered domain.
- the multidomain protein of the present invention can be used to generate bispecific antibodies.
- the multidomain protein may include a first bio- active domain containing an antibody variable domain and a second bio-active domain containing a second antibody variable domain with distinct specificity.
- the invention provides a multidomain protein, wherein the first bio-active region contains two or more antibody variable domains of a first specificity or of a first combination of specificities.
- the multidomain protein may also contain a second bio-active region including two or more antibody variable domains of a second specificity or second combination of specificities.
- the multidomain protein may include one or more single-chain Fv moieties, a diabody (one VH-VL chain), a single-chain diabody [a VH(I) - VL(2) VH(2) - VL(I)], or other single-chain Fv fused repeats (of the same or different specificities.
- the invention provides a multidomain protein, wherein the first bio-active region comprises two or more antibody variable domains of a first specificity or of a first combination of specificities.
- the multidomain protein further comprises a second bio-active region comprising two or more antibody variable domains of a second specificity or second combination of specificities that are substantially distinct from the first combination of specificities.
- the present invention further contemplates a method of colocalizing bio- active domains when administered to a biological system.
- the method includes the step of administering to the biological system the multimeric protein including first and second bio-active domains as described above in various embodiments, hi one embodiment, the biological system is a mammal, hi more preferred embodiment, the biological system is a human.
- the present invention provides a multidomain protein including at least first and second nonidentical engineered domains that meet at an interface.
- the interface of the first engineered domain contains at least two amino acid sequence segments, each segment being derived from a different naturally-occurring homologous parent domain, thereby conferring an assembly specificity distinct from the assembly specificity of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers.
- the second engineered domain also contains at least two amino acid sequence segments, each segment being derived from a different naturally-occurring homologous parent domain, thereby conferring an assembly specificity distinct from the assembly specificity of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers.
- the present invention provides a multidomain protein including at least first and second nonidentical engineered domains that meet at an interface, wherein (1) the first and second engineered domains are derived from two or more naturally-occurring homologous parent domains, (2) the interface from the first engineered domain comprises at least one amino acid sequence segment interacting with an amino acid sequence segment on the interface of the second engineered domain derived from the same parent domain, and (3) the first and second engineered domains form heterodimers with one another preferentially over forming homodimers.
- the present invention provides a multimeric protein including a domain with an amino acid sequence derived from two or more homologous parent domains and an interaction surface on said domain that mediates multimerization and that comprises amino acids derived from more than one of the parent domains; and wherein the specificity of multimerization is enhanced by the presence of amino acids from different parent domains.
- the domain is part of a polypeptide chain with a disulfide bond that enhances assembly.
- the present invention features an engineered immunoglobulin domain containing a protein-protein interaction interface including amino acids from two or more parent immunoglobulin domains such that the protein- protein interaction interface confers on the engineered immunoglobulin domain assembly specificities that are distinct from assembly specificities of the parent immunoglobulin domains, wherein the engineered immunoglobulin domain is not an antibody variable domain.
- the engineered immunoglobulin domain of the invention assembles with a partner domain with enhanced specificity compared to the parent domains.
- the partner domain is an engineered immunoglobulin domain of the invention.
- the present invention provides an engineered immunoglobulin superfamily domain containing a protein-protein interaction interface including amino acids from two or more parent immunoglobulin superfamily domains such that the protein-protein interaction interface confers on the engineered immunoglobulin superfamily domain interaction properties that are distinct from interaction properties of the parent immunoglobulin superfamily domains.
- the invention also provides a multidomain protein comprising an engineered domain with the following properties.
- the engineered domain comprises a protein-protein interaction interface.
- the engineered domain is homologous to a family of naturally occurring domains, preferably such that the amino acid sequence of the engineered domain can be aligned with amino acid sequences of naturally occurring domains, which can further be aligned with each other.
- the alignment of the amino acid sequences of the naturally occurring domains corresponds to an alignment of the three-dimensional structures of the naturally occurring domains.
- the interaction interface of the engineered domain comprises amino acids from corresponding sequence positions from two or more naturally-occurring parental domains.
- the amino acids in the interface of the engineered domain are not all found in the corresponding interface of any single member of the homologous naturally occurring domains.
- the interaction interface of the engineered domain confers assembly properties distinct from any of the parental domains.
- the assembly properties of the engineered domain are distinctive because the interaction interface has amino acids from two or more different parents that make specific contacts with assembly partners, thus acquiring an assembly specificity that is a hybrid between the assembly specificities of the parent domains.
- the present invention provides nucleic acid encoding a multidomain protein as described in various embodiments above.
- the present invention provides nucleic acid encoding a multidomain protein including at least one bio-active domain.
- the present invention also provides cells containing the nucleic acid of the invention.
- the present invention provides a method of designing a multidomain protein with domains that preferentially heterodimerize.
- the method includes the following steps: (a) selecting a first polypeptide, a second polypeptide, a third polypeptide and a fourth polypeptide, wherein the first and third polypeptides dimerize with each other, but not with the second or fourth polypeptide, and wherein said second and fourth polypeptides dimerize with each other, (b) composing an amino acid sequence of a first domain from the first and the second polypeptides comprising at least one assembly element from the first polypeptide, and (c) composing an amino acid sequence of a second domain from the third and fourth polypeptides comprising at least one assembly element from the third polypeptide, such that the assembly elements from the first and third polypeptides assemble with each other, promoting heterodimerization of the first and second domains.
- the method of the invention composes an amino acid sequence of the first domain further including an assembly element from the second polypeptide and an amino acid sequence of the second domain further including an assembly element from the fourth polypeptide such that the assembly elements from the second and fourth polypeptides assemble with each other, promoting heterodimerization of the first and second domains.
- step (b) or step (c) of the above-described method includes comparing three-dimensional structures of two or more of the first, second, third or fourth polypeptides. In some embodiments, identical first and third polypeptides are selected. In other embodiments, identical first and third polypeptides are selected and identical second and fourth polypeptides are selected.
- step (b) or step (c) of the above-described method includes comparing aligned amino acid sequences of two or more of the first, second, third or fourth polypeptides. In some embodiments, identical first and third polypeptides are selected. In other embodiments, identical first and third polypeptides are selected and identical second and fourth polypeptides are selected.
- the invention relates to:
- a multidomain protein comprising at least a first and a second nonidentical engineered domain, each of the first and the second engineered domain containing a protein-protein interaction interface comprising amino acid sequence segments derived from two or more naturally occurring homologous parent domains, thereby conferring on said first and second engineered domains assembly specificities distinct from assembly specificities of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers;
- the multidomain protein comprises a first subunit comprising the first engineered domain and a second subunit comprising the second engineered domain;
- immunoglobulin superfamily domains are antibody CH3 domains
- CH3 domains comprise IgG and IgA CH3 domains
- first and second engineered domains are part of polypeptide chains that are associated by a disulfide bond
- a corresponding multidomain protein wherein one of the first and second engineered domains comprises at least two non-adjacent sequence segments derived from the same parent domain
- each of the first and second engineered domains comprises at least two non- adjacent sequence segments derived from the same parent domain
- each of the amino acid sequence segments comprises two or more amino acids
- the first bio-active domain comprises an antibody variable domain
- the multidomain protein further comprises a second bio-active domain comprising a second antibody variable domain with distinct specificity.
- a multidomain protein comprising at least first and second nonidentical engineered domains that meet at an interface, the interface of each of the first and second engineered domains comprising at least two amino acid sequence segments, each derived from a different naturally-occurring homologous parent domain, thereby conferring a assembly specificity distinct from the assembly specificity of the parent domains, wherein the first and second engineered domains form heterodimers with one another preferentially over forming homodimers;
- a corresponding multidomain protein comprising at least first and second nonidentical engineered domains that meet at an interface, wherein (1) the first and second engineered domains are derived from two or more naturally-occurring homologous parent domains, (2) the interface from the first engineered domain comprises at least one amino acid sequence segment interacting with an amino acid sequence segment on the interface of the second engineered domain derived from the same parent domain, and (3) the first and second engineered domains form heterodimers with one another preferentially over forming homodimers;
- a multimeric protein comprising o a domain with an amino acid sequence derived from two or more homologous parent domains; o an interaction surface on said domain that mediates multimerization and that comprises amino acids derived from more than one of said parent domains; and wherein the specificity of multimerization is enhanced by the presence of amino acids from different parent domains;
- a corresponding multimeric protein wherein the domain is part of a polypeptide chain that comprising a cysteine that forms a disulfide bond that enhances multimerization;
- an engineered immunoglobulin domain containing a protein-protein interaction interface comprising amino acids from two or more parent immunoglobulin domains such that the protein-protein interaction interface confers on the engineered immunoglobulin domain assembly specificities that are distinct from assembly specificities of the parent immunoglobulin domains, wherein the engineered immunoglobulin domain is not an antibody variable domain;
- a corresponding engineered immunoglobulin domain wherein the engineered immunoglobulin domain assembles to a partner domain with enhanced specificity compared to said parent domains.
- an engineered immunoglobulin superfamily constant domain containing a protein- protein interaction interface comprising amino acids from two or more parent immunoglobulin domains such that the protein-protein interaction interface confers on the engineered immunoglobulin domain interaction properties that are distinct from interaction properties of the parent immunoglobulin domains.
- a multidomain protein comprising an engineered domain that comprises a protein- protein interaction interface, said domain being homologous to a family of naturally-occurring domains, said interface comprising amino acids that are found in corresponding sequence positions in two or more said naturally-occurring domains, said amino acids not all being found at corresponding sequence positions in any single member of said family of naturally-occurring domains;
- a heterodimeric engineered immunoglobulin molecule comprising a first naturally occurring immunoglobulin chain derived from a first member of the immunoglobulin superfamily and a second naturally occurring immunoglobulin chain derived from a second different member of the immunoglobulin family, wherein each of the immunoglobulin chains comprises a bio-active domain, which is not an antibody variable region and comprises a protein-protein interface domain, that comprises complementary amino acid segments from the other immunoglobulin superfamily chain; said protein-protein interface of the first chain is interacting with the protein-protein interface domain of the second chain by dimerization, preferably homodimerization of the corresponding amino acid segments derived from the same immunoglobulin superfamily within said interaction domains;
- bio-active domain is an antibody CH3 domain, a CH2-CH3 domain or a CHl- CH2-CH3 domain;
- nucleic acid encoding a multidomain protein comprising at least first and second nonidentical engineered domains, each of the first and second engineered domains containing protein-protein interaction interface comprising amino acid sequence segments derived from two or more naturally occurring homologous parent domains, thereby conferring assembly specificities of said first and second engineered domains distinct from assembly specificities of the parent domains, wherein (1) the first and second engineered domains form heterodimers with one another preferentially over forming homodimers, and (2) the first and second engineered domains are not antibody variable domains; • a cell comprising the nucleic acid as described;
- first domain further comprises a assembly element from the second polypeptide and the second domain further comprises a assembly element from the fourth polypeptide such that the assembly elements from the second and fourth polypeptides bind assemble with other promoting heterodimerization of the first and second domains;
- step (b) or step (c) comprises comparing three- dimensional structures of two or more of the first, second, third or fourth polypeptides;
- FIG. IA schematically depicts an exemplary method of designing SEED constructs.
- Two related parent domains X and Y are aligned.
- the sequences of the two SEED subunits (XY and YX) are then generated by choosing for one SEED subunit alternating sequence segments from the two parental sequences, and choosing the complementary sequence segments to generate the other SEED subunit sequence.
- SEEDs engineered by this method are referred to as "Full" SEEDs.
- FIG. IB schematically depicts a second exemplary method of designing
- SEED constructs which is similar to FIG. IA except that only amino acids forming the dimerization interface are chosen from one of the parental sequences. SEEDs engineered by this method are also referred to as "Surface" SEEDs.
- FIG. 1C depicts diagrammatically exemplary configurations of a SEED heterodimer, composed of a first daughter SEED (white oval) and a second daughter SEED (black oval), and a fusion partner, such as a bioactive domain (stalked white diamond).
- the SEED moiety and the fusion partner may be coupled by a linker segment (not depicted).
- the fusion partners may be identical to one another or distinct from one another, although in the diagrams they are shown generically as a stalked white diamond.
- the fusion partner may be N- terminal (A) or C-terminal (B) to the SEED moiety.
- fusion partners there may be multiple concatenated fusion partners on one end of a SEED, as in (C), or the fusion partners may be located at opposite ends of a SEED (D).
- One fusion partner may be placed at N-terminal to a first daughter SEED and a second fusion partner may be placed N-terminal (F) or C-terminal (G) to a second daughter SEED.
- the SEED heterodimer may contain three (H) or four (I) fusion partners.
- FIG. 2 depicts the structural alignment of human IgGl CH3 (SEQ ID NO:51) and human IgA CH3 (SEQ ID NO:52) domains. Residue numbers are shown above and below the sequences. IgGl is numbered according to Kabat EU numbering, while IgA is sequentially numbered as in the PDB structure 1OWO. Bold letters designate the backbone positions that were included in the alignment described in Table 2 in Example 1. Diamonds designate residues that contact or come close to the dimerization interface in IgGl and IgA homodimers.
- FIG. 3 A depicts the sequence alignments and secondary structure of human IgA (SEQ ID NO:52), IgGl (SEQ ID NO:51) and daughter "Surface” SEED sequences "AG SURF” (SEQ ID NO: 10) and "GA SURF” (SEQ ID NO:11), while FIG. 3B depicts the sequence alignments and secondary structure of human IgA, IgGl and daughter "Full” SEED sequences "AG SEED” (SEQ ID NO:3) and "GA SEED” (SEQ ID NO:6).
- IgGl is numbered according to Kabat EU numbering, while IgA is sequentially numbered as in the PDB structure 1OWO (native numbers in center of alignment).
- the sequential numbering of the SEED sequence is interrupted at extra loop residues, which are designated with letters "A", "B”, etc. ⁇ e.g., 18A), to illustrate the structural alignment of the molecules.
- Strand exchange points are designated by bold sequence letters. The two exchange points that contain no common residues are italicized.
- Modeled secondary structures (arrows above and below sequences) of the two SEEDs illustrate the strand exchanges, and are colored to indicate the manner in which the domain was divided, as shown in Figs 6B and 6C.
- White segments D are from IgA; gray segments f ⁇ are from IgG, and black segments ⁇ are common residues at exchange points. Twelve (12) residues in IgA segments are underlined.
- FIG. 4 is a representation of an IgG antibody molecule illustrating the symmetry of the CH3 homodimer.
- the vertical bar designates the axis of 2-fold rotational symmetry.
- FIG. 5 is a representation of a bispecific, antibody-like molecule having two different Fab domains, paired by the heterodimeric SEED analogue of the CH3 domain.
- the hashed, gray portion represents the IgG-derived portion, while the white D represents the IgA-derived portion.
- the symmetry of the CH3 complex is broken in the AG/GA heterodimer, as represented by the "X" on the vertical bar designating the axis of two-fold rotational symmetry.
- FIGs. 6A-C are schematic representations of the secondary structure of
- FIG. 6A depicts the secondary structure of wild type CH3.
- FIG. 6B depicts the secondary structure of the "GA SEED," and shows the strand exchange pattern.
- Gray H represents IgG sequence
- white D represents IgA sequence
- black ⁇ shows the exchange points, with a broader black band indicating residues that are conserved in both IgA and IgG.
- FIG. 6C depicts the secondary structure of the "AG SEED,” which contains a pattern opposite to the pattern of the "GA SEED".
- FIGS. 7A-C are ribbon diagram representations of the three-dimensional structure of the "GA SEED” and “AG SEED” CH3 domains and of their putative heterodimeric structure depicting exchange crossover point and CH3 domain interactions.
- white or light gray ribbons represent IgA sequence and structure
- dark gray corresponds to IgG sequence and structure
- black sections denote where the sequence exchanges from G to A or vice versa.
- all black residues are shared by IgA and IgG, in sequence and in basic structure.
- FIG. 7A depicts the "GA SEED," where the N-terminus begins as IgG sequence and ends as IgA after exchanging seven times.
- the upper layer of ⁇ -strands are in the outside sheet, while the layer behind forms the interface with the other CH3 domain.
- FIG. 7B depicts the "AG SEED,” beginning with IgA sequence.
- the front ⁇ -strands form the interface, while the ⁇ -strands behind are on the outside of the dimer.
- FIG. 7C depicts the putative heterodimeric structure of the "GA SEED” and "AG SEED.”
- Translating the structure shown in FIG. 7 A over the structure shown in FIG. 7B brings the interface surfaces together.
- the black residues form an approximate plane that is oriented vertically and perpendicular to the page.
- All residues to the left are dark gray (IgG), while all residues to the right are white (IgA).
- IgG dark gray
- IgA white
- the alternative homodimers, (AG/AG and GA/GA) would each have their IgA side juxtaposed to their IgG side (on both sides of the dividing plane), and so are disfavored.
- FIGs. 8 - 10 diagrammatically show a series of protein molecules that can be made using the SEED moieties described herein. For all of these figures, different moieties are indicated as follows.
- polypeptide chains that include the GA SEED are colored black, while the polypeptide chains that include the AG SEED are colored white.
- antibody V regions that are part of the GA SEED-containing polypeptide chain are black with thin white stripes, while antibody V regions that are part of the AG SEED-containing polypeptide chain are white with thin black stripes.
- Light chain constant regions are shown with a checkerboard pattern.
- Antibody hinge regions are shown as thin ovals connected by an "S-S" and a thick line to represent the disulfide bonds between the hinge regions.
- Polypeptide linkers are represented with dashed lines.
- “16”, “17”, “18”, or “19” refers to any protein or peptide, such as a non-Ig domain. Such domains may include, for example, cytokines, hormones, toxins, enzymes, antigens, and extracellular domains of cell surface receptors. "20” indicates a canonical homodimeric Fc region.
- FIG. 8 illustrates types of antibody-type SEED configurations comprising moieties with essentially naturally occurring V regions, such as the Fab (FIG. 8A and FIG. 8B), single-chain Fab (FIG. 8C and FIG. 8D), and single-domain or camelid single- domain V regions (FIG. 8E and FIG. 8F).
- FIG. 8A, FIG. 8C, and FIG. 8E show molecules comprising an essentially intact Fc region, including CH2 domains, as well as a hinge.
- FIG. 8B, FIG. 8D, and FIG. 8F show molecules lacking a CH2 domain, in which the hinge is optionally replaced by a linker that optionally possesses or lacks cysteine residues capable of disulfide bonding.
- FIG. 9 illustrates types of antibody-type SEED configurations comprising moieties with artificially configured V regions, such as single-chain Fvs (FIG. 9A and FIG. 9B), diabodies (FIG. 9C and FIG. 9D), and single-chain Fvs with additional moieties attached to the N- and/or C-termini of the two polypeptide chains (FIG. 9E and FIG. 9F).
- FIG. 9A, FIG. 9C, and FIG. 9E show molecules comprising an essentially intact Fc region, including CH2 domains, as well as a hinge.
- FIG. 9B, FIG. 9D, and FIG. 9F show molecules lacking a CH2 domain, in which the hinge is optionally replaced by a linker that optionally possesses or lacks cysteine residues capable of disulfide bonding.
- FIG. 10 diagrammatically illustrates a molecule in which a GA/AG SEED pair essentially replaces the CHl-CL pairing in an antibody.
- Additional moieties indicated by X and Y, may be placed at the N-termini of the GA and AG SEEDs.
- Moiety X and moiety Y can be, for example, a Fab, a single-chain Fab, a camelid single-domain V region, a single-chain Fv, a single-chain diabody such as that illustrated by "14" and "15" in FIG. 9C and FIG. 9D.
- Additional moieties may be fused to the C-termini of the CH3 domains indicated by "21".
- FIG. U shows an Fc heterodimer produced as described in Example 5, in which an AG SEED moiety has an IL-2 moiety fused to its C-terminus.
- the CH2 and hinge moieties are identical in this case.
- FIG. 1 IB shows an antibody produced as described in Example 7, in which an AG SEED moiety has an IL-2 moiety fused to its C-terminus.
- Each antibody domain is represented by an oval, and the IL-2 moiety is represented by a white square.
- the CH2, CHl, hinge, VH, VL, and CL moieties are identical in this case.
- the hinge regions are attached by disulfide bonds represented by "S-S" in the figure.
- the light chain constant region is represented with a checkerboard pattern.
- the light chain V region is represented with a vertical-striped pattern.
- the VH, CHl, and CH2 regions are black.
- FIG. 12 depicts the preferential assembly of AG/GA SEEDS into heterodimers as represented by the results of expression of Fc and Fc-IL2 in the same cell.
- FIG. 12 A depicts the possible configurations of molecules resulting from coexpression of Fc and Fc-IL2, such that each dimeric species has a different molecular weight.
- FIG. 12 A depicts the possible configurations of molecules resulting from coexpression of Fc and Fc-IL2, such that each dimeric species has a different molecular weight.
- FIG. 12B depicts a non-reducing SDS gel in which the following samples were loaded: lane 1 — molecular weight standards; lane 2-4 - about 1, 2, and 4 micrograms of total protein of the "full" Fc(GA SEED)/Fc(AG SEED)-IL2 expressed from NS/0 cells; lane 5-7 - about 1, 2, and 4 micrograms of total protein of the "surface" Fc(GA SEED)/Fc(AG SEED)-IL2 expressed from NS/0 cells; lane 8-10 - about 1, 2, and 4 micrograms of total protein of the parental IgG Fc/Fc-IL2 expressed from NS/0 cells.
- FIG. 12C is a reducing gel showing the ratio of expression of IgG-derived Fc and Fc-IL2.
- FIGs. 12D-E depict Western blot analysis of non-reduced samples (panel D) and reduced samples (panel E) of the Fc/Fc-IL2 proteins of FIGs. 12B-C.
- Duplicate samples of "full" Fc(GA SEED)/Fc(AG SEED)-IL2 (lanes 1 and 4), "surface” Fc(GA SEED)/Fc(AG SEED)-IL2 (lanes 2 and 5), and parental Fc/Fc-IL2 (lanes 3 and 6) were loaded and the blot was probed using anti-human IgG Fc (lanes 1-3) and anti-human IL-2 (lanes 4-6) antibodies.
- the present invention provides methods for designing protein domains that preferentially heterodimerize or heteromultimerize.
- the invention uses a "Strand Exchange Engineered Domain” (SEED) strategy to engineer a protein-protein interaction interface that promotes heterodimerization or heteromultimerization.
- SEED Simple Exchange Engineered Domain
- the invention also provides multidomain proteins containing domains engineered using this approach.
- the present invention represents a significant advance in protein engineering.
- a “multidomain protein” includes any protein containing two or more domains.
- the domains may be on single polypeptide; they may also be on different polypeptides.
- “Heteromultimerization” refers to nonidentical domains forming a multimeric complex mediated by domain interactions.
- a “heteromultimeric protein” is a protein molecule comprising at least a first subunit and a second subunit, each subunit contains a nonidentical domain.
- the heteromultimer can include a "heterodimer” formed by the first and second subunit or can form higher order structures (e.g., ternary) where subunit polypeptides in addition to the first and second subunit are present. Typically, each subunit contains a domain.
- Exemplary structures for the heteromultimer include heterodimers, heterotrimers, heterotetramers (e.g., a bispecific antibody) and further oligomeric structures.
- a "domain” includes any region of a polypeptide that is responsible for selectively assembling with an assembly partner of interest (e.g., another domain, ligand, receptor, substrate or inhibitor).
- exemplary domains include an immunoglobulin superfamily constant domain such as a CH2 or CH3 domain, a receptor binding domain, a ligand binding domain, an enzymatic domain, or any polypeptide that has been engineered and/or selected to bind to a target. When two domains assemble with each other, they meet at a protein-protein interaction interface.
- a "protein-protein interaction interface,” an “interaction interface,” or an “interface” includes those "contact” residues (amino acid or other non-amino acid residues such as carbohydrate groups, NADH, biotin, FAD or heme group) in the first domain that interact with one or more "contact” residues (amino acid or other non-amino acid groups) in the interface of the second domain.
- a "contact" residue refers to any amino acid or non-amino acid residue from one domain that interacts with another amino acid or non-amino acid residue from a different domain by van der Waals forces, hydrogen bonds, water-mediated hydrogen bonds, salt bridges or other electrostatic forces, attractive interactions between aromatic side chains, the formation of disulfide bonds, or other forces known to one skilled in the art.
- the distance between alpha carbons of two interacting contact amino acid residues in the interaction interface is no greater than 12 A. More typically, the distance between alpha carbons of two interacting contact amino acid residues in the interaction interface is no greater than 11 A.
- a "parent domain” refers to any existing assembly domain as described above that can be used as a parent sequence for designing an engineered domain by the strand exchange strategy. Suitable parent domains are typically related or homologous and have particular assembly specificity. "Homologous” typically means two domains sharing at least 35%, 40%, 45%, 50%, 55%, 60%, 62%, 65%, 68%, 70%, 75%, 80%, 85%, 90%, 95% or 99% sequence identity. If parent domains are present in a common solution, they may tend to homodimerize rather than heterodimerize with one another.
- existing assembly domains include wild-type or naturally- occurring sequences from organisms such as human, mouse, yeast, bacteria, to name but a few, as well as derivative sequences that have been modified from the wild-type sequences, such as, for example, sequences that have been stabilized; rendered less immunogenic; given altered, enhanced or diminished assembly specificity, altered enzymatic properties, altered solubility, or enhanced expression; truncated; or fused to another polypeptide.
- Existing assembly domains can also be partially- or fully- synthetic sequences that are synthesized based on molecular design, in vitro or in vivo selection methods (e.g., yeast two-hybrid system, phage display), or combinations thereof.
- an “engineered domain” refers to a domain engineered from at least two nonidentical parent domains.
- An engineered domain is also referred to as a daughter domain.
- an engineered domain of the present invention contains amino acid sequence segments derived from two or more existing homologous parent domains.
- the interface of an engineered domain includes amino acids derived from more than one parent domain.
- the presence of amino acids from different parent domains confers a assembly specificity distinct from the assembly specificities of the parent domains. For example, the presence of the amino acids from different parent domains promotes or enhances heterodimerization or heteromultimerization.
- a Strand Exchange Engineered Domain is an engineered domain that is engineered from at least two nonidentical parent domains by the strand exchange engineering method described in detail below.
- polypeptide refers generally to any polypeptide or protein having more than about ten amino acids.
- polypeptides Preferably, mammalian polypeptides
- polypeptides that were originally derived from a mammalian organism are used for
- SEED engineering more preferably those which are directly secreted into the medium.
- bacterial polypeptides include, e.g., alkaline phosphatase and ⁇ -lactamase.
- mammalian polypeptides include molecules such as renin, a growth hormone, including human growth hormone; bovine growth hormone; growth hormone releasing factor; parathyroid hormone; thyroid stimulating hormone; lipoproteins; ⁇ -1- antitrypsin; insulin A-chain; insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin; luteinizing hormone; glucagon; clotting factors such as factor VIIIC, factor IX, tissue factor, and von-Willebrands factor; anti-clotting factors such as Protein C; atrial natriuretic factor lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor; tumor necrosis factor- ⁇ and - ⁇ ; enkephalinase; RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-
- first polypeptide or “first subunit” is any polypeptide which is to be associated with a second polypeptide through the interaction between the engineered domains.
- second polypeptide or “second subunit” is any polypeptide which is to be associated with the first polypeptide through the interaction between the engineered domains.
- the first and/or the second polypeptide may include one or more additional bio-active domains, such as, for example, an antibody variable domain, receptor binding domain, ligand binding domain or enzymatic domain) or other "binding domains” such as antibody constant domains (or parts thereof) including CH3 and CH2 domains.
- the first polypeptide may include at least one engineered domain of the invention, such as an engineered CH3 domain of an immunoglobulin and can form the interface of the first polypeptide.
- the first polypeptide may further include other antibody heavy chain binding domains (e.g., CHl, CH2, or CH4), and additional bio-active domains, such as receptor polypeptides (especially those which form dimers with another receptor polypeptide, e.g., interleukin-8 receptor and integrin heterodimers, e.g., LFA-I or GPIIIb/IIIa), ligand polypeptides (e.g., cytokines, nerve growth factor, neurotrophin-3, and brain-derived neurotrophic factor -see Arakawa et al.
- receptor polypeptides especially those which form dimers with another receptor polypeptide, e.g., interleukin-8 receptor and integrin heterodimers, e.g., LFA-I or GPIIIb/IIIa
- assembly refers to a protein-protein interaction that occurs during the production of a multisubunit protein.
- the heavy and light chains are synthesized from ribosomes associated with the endoplasmic reticulum. The individual chains then fold, and then assemble into mature antibodies through proper association of heavy and light chains.
- the assembly of the Fab portion is initially driven primarily by interactions between the CHl and CL domains, and also by interactions between the VH and VL regions.
- the initial assembly reaction is the association of the two CH3 domains.
- assembly refers to the protein interaction events that occur during production of a mature protein, such as an antibody before it is secreted from a cell, while binding refers to protein interaction events that occur after secretion, such as the interaction of an antibody with an antigen or with an Fc receptor.
- assembly of a therapeutic or diagnostic protein occurs during the preparation of the therapeutic protein up to and including the placement of a product in a vial, and binding of a therapeutic or diagnostic protein refers to events that occur after a therapeutic protein is administered to a patient or when a diagnostic protein is used in a diagnostic test.
- binding is meant the interaction of a protein with a target protein subsequent to the synthesis and assembly of the protein.
- the invention uses the fact that natural protein domains mediating protein- protein interactions are often homologous or, in the case of homodimers, identical, and that such proteins and domains often only homodimerize with themselves but typically do not heterodimerize with other family members or do not heterodimerize with other family members with an affinity equal to or greater than their affinities for homodimerization.
- such proteins may be used to design heterodimeric or heteromultimeric proteins using strand exchange engineered methods described in detail below.
- engineered domains are also referred to as "Strand Exchange Engineered Domains" (“SEEDs").
- SEEDs String Exchange Engineered Domains
- Multidomain proteins containing such engineered domains are also referred to as strand exchange engineered proteins.
- Strand exchange engineering typically begins with a structural model of a dimeric parent protein domain.
- Two parent domains that can each homodimerize or dimerize with its own assembly partner but not heterodimerize with each other are structurally aligned.
- the parent domains may dimerize in a face-to-face manner, i.e., the dimer partners may be related by a 180-degree rotational symmetry.
- the parent domains may also dimerize in a front-to-back manner.
- the engineered domains of the invention are not leucine-zipper domains.
- the CH3 family domains are particular useful because a significant portion of the interaction surface lies outside the line of symmetry. It however will be recognized by those skilled in the art that the line of symmetry (i.e., a line of homotypically interacting amino acids) may be an oversimplification. For example, the side-chains of amino acids on the line of symmetry may point toward the hydrophobic core of the domain.
- a new dimerization interface is conceptually designed and divided into at least two regions which typically lie on either side of the homotypic interaction line (i.e., the line of symmetry). New domains are then designed by strand exchange wherein two daughter domain linear amino acid sequences are constructed from two aligned parent domain amino acid sequences by taking complementary segments from each parent sequence. As a result, in the regions of the dimerization interface, the two daughter domains (i.e., two SEEDs) have complementary amino acid segments from parent domains.
- Figures IA and IB As shown in Figure IA, two daughter SEED sequences, 1 and 2, are engineered from two parent sequences, A and B, in an entirely complementary manner.
- the interaction interface is designed such that at least one amino acid sequence segment on Daughter 1 interacts with an amino acid sequence segment on daughter 2 that derived from the same parent domain.
- the daughter SEED domains are derived primarily from one parent domain. However, the amino acids at the dimerization interface on either daughter SEED domain are derived from either one parent or another in a complementary manner.
- Figure IA and Figure IB represent two extreme examples of the invention, and that SEEDs may be engineered by methods of the invention that have designs intermediate between Figure IA and Figure IB.
- SEEDs may be engineered by methods of the invention that have designs intermediate between Figure IA and Figure IB.
- the daughter SEEDs may be derived primarily in a complementary manner from IgG and IgA, but the amino acids that interact with FCRB are derived from IgG to preserve the interaction with FcRn.
- SEEDs are typically engineered by combining two or more homologous parent domains.
- the parent domains are polypeptides that differ from one another by at least four amino acids.
- the sequences of the original polypeptides are aligned based on their homologies, theoretical structural models, crystal or solution structures, or any combinations thereof.
- the parent sequences are then divided into at least two segments including at least one amino acid each.
- a SEED sequence may be composed by choosing, from among the original sequences, the one desired for each divided segment.
- a SEED will often differ from each individual parent sequence by at least two consecutive amino acids, and sometimes by three, four or more consecutive amino acids.
- a SEED can contain any desired amino acids at any positions, such as positions outside the designed interface, in order to satisfy the other design needs.
- exchange points or exchange positions There are positions on the sequence of the SEED where the parent sequence changes from one parent to a second parent. These positions are called exchange points or exchange positions.
- Exchange points or exchange positions can include one or more amino acids whose identity may be shared by both parents. Typically, exchange points are chosen from the amino acids on or near the line of symmetry, although other exchange points can also be chosen. Exchange points can also include amino acids not shared by the parents. In this case, the sequence abruptly switches from one parent to another.
- exchange points can include one or more novel amino acids not belonging to any of the parents. In this case, typically, different parent sequences appear on either side of the novel amino acids.
- the total number of parent segments can be greater than two, up to a number one greater than the number of exchange points. These parent segments can be selected from distinct parent domains.
- the present invention contemplates SEEDs that are engineered from more than two parent domains.
- each SEED is typically named according to the order of its parent sequences, beginning with the N-terminus of the SEED, hi the examples given below, an AG SEED has an IgAl sequence segment on the N-terminal end, which then changes to an IgGl sequence segment at the first exchange point.
- a GA SEED has an IgGl sequence segment on the N-terminal end, which then changes to an IgAl sequence at the first exchange point.
- the interaction interface of the SEEDs of the invention includes amino acid sequence segments derived from two or more parent domains. As a result, the interface of the SEEDs has interaction properties distinct from interaction properties of the parent domains.
- the presence of amino acids from different parent domains confers an assembly specificity distinct from the assembly specificity of either of the parent domains.
- the specificity of heterodimerization or heteromultimerization is enhanced by the presence of amino acids from different parent domains on the interface of a SEED.
- a pair of SEEDs form heterodimers with one another preferentially over forming homodimers.
- heterodimers of the SEEDs can specifically assemble such that the heterodimeric SEEDs can be directly recovered from the cell culture system without the need for elaborate separation steps to remove the homodimers.
- SEEDS can be created by using parental sequences from two different immunoglobulin classes.
- SEEDs can be engineered from CH3 family domains by the method of the invention.
- CH3 family domains suitable for designing SEEDs include, but are not limited to, CH3 domains of IgGl, IgG2, IgG3, IgG4, IgA, and IgD, and the CH4 domains of IgE and IgM.
- CH3 domains of human IgGl and IgA form homodimers but do not form heterodimers with each other. Therefore, pairs of SEEDs (e.g., an AG SEED and a GA SEED) can be engineered from IgGl and IgA CH3 domains such that they can heterodimerize with each other but their ability to homodimerize is minimal.
- the assembly interface on the CH3 domain is divided into two regions, which lie on either side of the line of homotypic interactions. Homotypic interactions for the IgA and IgGl CH3 domains can be determined by observation and probing the crystal structure with a 1.4A sphere to determine whether or not the two side chains are close enough to exclude water.
- the homotypically interacting amino acids include, but are not limited to, L351, P352, T366, T394, P395, and Y407.
- the homotypically interacting amino acids include, but are not limited to, L352, P353, T368, W398, A399 and T414.
- those amino acids with outwardly-pointing side-chains that lie to the left of the line of homotypic interaction are taken from the CH3 of IgGl, and those with outwardly-pointing side- chains to the right of the line of homotypic interaction are taken from the CH3 of IgA.
- those amino acids with outwardly-pointing side-chains that lie to the left of the line of homotypic interaction are taken from the CH3 of IgA, and those with outwardly-pointing side-chains to the right of the line of homotypic interaction are taken from the CH3 of IgGl.
- the choice of amino acids along the line of homotypic interaction is based on structural considerations and performed on a case-by-case basis, although it is likely that the amino acids from either parent domain can be selected for a particular region of a SEED.
- a CH3-based AG SEED may have a polypeptide sequence as shown in SEQ ID NO: 1 , wherein Xi, X 2 , or X 3 may be any amino acids.
- Xi is K or S
- X 2 is V or T
- X 3 is T or S.
- Xi is S
- X 2 is V or T
- X 3 is S.
- a CH3 -based GA SEED may have a polypeptide sequence as shown in SEQ ID NO:2, wherein Xj, X 2 , X 3 , X 4 , X 5 , or X 6 may be any amino acids, hi some embodiments, X 1 is L or Q, X 2 is A or T, X 3 is L, V, D, or T, X 4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T, X 5 is A or T, and X 6 is E or D.
- Xi is Q
- X 2 is A or T
- X 3 is L
- X 4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T
- X 5 is T
- X 6 is D.
- Exemplary SEED heterodimers may include one SEED subunit selected from AG(fO) SEED (SEQ ID NO:3), AG(fl) SEED (SEQ ID NO:4), or AG(f2) SEED (SEQ ID NO:5), and the other SEED subunit selected from GA(f0) SEED (SEQ ID NO:6), GA(fl) SEED (SEQ ID NO:7), GA(f2) SEED (SEQ ID NO:8), or GA(f3) SEED (SEQ ID NO:9).
- a SEED heterodimer may include AG(f0) SEED (SEQ ED NO:3) and GA(f0) SEED (SEQ ID NO:6) subunits.
- a SEED heterodimer may include AG(G) SEED (SEQ ID NO:5) and GA(f2) SEED (SEQ ID NO:8) subunits.
- a SEED heterodimer may include AG(s0) SEED (SEQ ID NO: 10) and GA(sO) SEED (SEQ ID NO:11) subunits.
- the SEEDs according to this invention are particularly useful when coupled with a fusion partner.
- a fusion partner (X) can be fused to the N-terminus of the SEED (X-SEED), it can also be fused to the C-terminus of the SEED (SEED-X).
- SEED-X the C-terminus of the SEED
- a fusion partner can be fused to the N-terminus and the C-terminus of the SEED at the same time (X-SEED-X).
- Two different fusion partners can be fused to a SEED (X- SEED-Y).
- the first daughter SEED has one fusion partner
- the second daughter SEED has no fusion partner, resulting in the following exemplary configurations: SEED-X heterodimerized to SEED; or X-SEED heterodimerized to SEED.
- the first daughter SEED has two different fusion partners (X, Y), and the second daughter SEED has two different fusion partners (W, Z) differing from the fusion partners of the first daughter SEED.
- Possible exemplary configurations includes, but are not limited to: X-SEED-Y heterodimerized to W-SEED-Z; X-SEED-Y heterodimerized to Z-SEED-W; Y-SEED-X heterodimerized to W-SEED-Z; or Y-SEED-X heterodimerized to Z-SEED-W.
- a SEED can also have two or more fusion partners (X) fused sequentially to, for example, the N-terminus (X-X-SEED).
- the first daughter SEED has one fusion partner (X), and the second daughter SEED has one fusion partner (Y), resulting in the following exemplary configurations: X-SEED heterodimerized to Y-SEED; X-SEED heterodimerized to SEED-Y; or SEED-X heterodimerized to SEED-Y.
- the first daughter SEED has one fusion partner (X), and the second daughter SEED has two fusion partners (Z, Y).
- Possible exemplary configurations include, but are not limited to: X- SEED heterodimerized to Y-SEED-Z; X-SEED heterodimerized to Z-SEED-Y; SEED-X heterodimerized to Z-SEED-Y; or SEED-X heterodimerized to Y-SEED-Z. Exemplary configurations are illustrated in Figure 1C.
- a fusion partner can be one or more bio-active domains including any biologically active protein or a biologically active portion thereof.
- a bio-active domain can include an antibody constant or variable region, including, but not limited to, a VL domain, a VH domain, an Fv, a single-chain Fv, a diabody, an Fab fragment, a single-chain Fab, or an F(ab') 2 .
- the fusion partners can be coupled to the SEED moieties directly or indirectly.
- a fusion partner may be linked to a SEED moiety by a peptide linker, such as described in U.S. Patent Nos. 5,258,498 and US 5,482,858 to Huston et al, or U.S. Patent Nos. 5,856,456 and US 5,990,275 to Whitlow et al, the teaching of which are hereby incorporated by reference.
- a suitable peptide linker may contain glycine and serine residues.
- a suitable peptide linker may also have different properties.
- a linker may further include a protease cleavage site, such as a matrix metalloproteinase recognition site.
- a multispecific antibody is a molecule having binding specificities for at least two different antigens. While such molecules typically will only bind two antigens (i.e. BsAbs), antibodies with additional specificities such as trispecific or tetraspecific antibodies are encompassed by this expression when used herein.
- BsAbs include those that bind to different antigens on the same cell surface, or those that bind to a cell surface antigen and a non- cell surface antigen.
- a non-cell surface antigen includes, but is not limited to, an extracellular or intracellular antigen, a soluble or insoluble antigen.
- the multispecific antibodies may bind to different antigens simultaneously, although simultaneous binding is not required for the function of the multispecific antibodies.
- the antigens are preferentially functionally related, such as EGFR and HER2.
- Particularly useful types of multispecific antibodies include, but are not limited to, anti-EGFR/anti- HER2; anti-EGFR/anti-HER2/anti-HER3; anti-EGFR/anti-HER3; anti-EGFR/anti- HER2/anti-IGF 1 R; anti-EGFR/anti-HER2/anti-HER3/anti-IGF 1 R; anti-EGFR/anti- HER3/anti-IGFlR; anti-EGFR/anti-IGFIR; and anti-HER2/anti-IGFlR.
- BsAbs include those with one arm directed against a tumor cell antigen and the other arm directed against a cytotoxic trigger molecule such as anti-Fc ⁇ RI/anti-CD15, anti-pl85 HER2 /Fc ⁇ RIII (CD16), anti-CD3/anti-malignant B-cell (IDlO), anti-CD3/anti- pl85 HER2 , anti-CD3/anti-p97, anti-CD3/anti-renal cell carcinoma, anti-CD3/anti-OVCAR-3, anti-CD3/L-Dl (anti-colon carcinoma), anti-CD3/anti- melanocyte stimulating hormone analog, anti-EGF receptor/anti-CD3, anti-CD3/anti- CAMAl, anti-CD3/anti-CD19, anti-CD3/MoV18, anti-neural cell adhesion molecule (NCAM)/anti-CD3, anti-folate binding protein (F
- bio-active domains include hormones, cytokines, chemokines, secreted enzymes, ligands, extracellular portions of transmembrane receptors, or receptors.
- Hormones include, but are not limited to, growth hormones, or glucagon- like peptide (GLP-I).
- Cytokines include, but are not limited to, interleukin-2 (IL-2), IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL- 18, IL-21 , IL-23, IL-31; hematopoeitic factors such as granulocyte-macrophage colony stimulating factor (GM-CSF), G-SCF and erythropoietin; tumor necrosis factors such as TNF- ⁇ ; lymphokines such as lymphotoxin; regulators of metabolic processes such as leptin; and interferons (IFN) such as IFN- ⁇ , IFN- ⁇ , and IFN- ⁇ .
- IL-2 interleukin-2
- IL-4 interleukin-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL- 18, IL-21 , IL-23
- the engineered heteromeric proteins of the present invention permit the colocalization of different bio-active domains in a biological system. This can be accomplished, for example, in the context of a multimeric protein incorporating two different antibody variable domains, where one antibody variable domain is fused to one engineered domain and a second antibody variable domain is fused to a second engineered domain that preferentially assembles with the first engineered domain.
- Administration of such an engineered protein causes two distinct activities — in this case, binding activities — to be present in the same molecule in the biological system, colocalizing the activities within the biological system.
- the present invention provides a system to require that the activities be present at the same place permitting, for example, the targeting of a therapeutic activity to a particular cell type or location; the crosslinking of different receptors or cells; the colocalization of an antigen and adjuvant; etc.
- This can be accomplished by direct administration of an engineered heteromeric protein to a biological system or by expression of nucleic acid encoding the subunits within the biological system. Nucleic acid expression permits the engineering of additional levels of control in the system. For example, the expression of each subunit can be differentially regulated, such that the complete heteromeric protein and the resulting colocalization of activities occurs only upon the occurrence of all conditions required for expression of each subunit.
- the SEED sequences can be modified to reduce their potential immunogenicity. Because SEED polypeptides are hybrids between two different naturally occurring human sequences, they include sequence segments at their junctions that are not found in natural human proteins. In an organism, these sequence segments may be processed into non-self T-cell epitopes. [0085] Methods to analyze peptide sequences for their potential to create T-cell epitopes are well known in the art. For example, ProPred
- the AG SEED and GA SEED sequences are modified to remove one or more T-cell epitopes present in the SEED sequence.
- This modification may include substitution, deletion, or modification of one or more amino acid residues in order to remove the T-cell epitope.
- Table 1 presents a list of peptide sequences that are potential T-cell epitopes in the AG SEED and GA SEED, and possible amino acid substitutions that are predicted to reduce or remove the T-cell epitope.
- V75T 69 VTSKLTVDK (SEQ ID NO:14)
- LDSDGSFFL (SEQ ID NO: 21) L61V, D, T 67 FFLYSILRV (SEQ ID NO:22) F67A, D, E, G, H, K, N, P, Q, R, S, T
- SEED G(f0) SEED (SEQ ID NO:6) polypeptides, and some exemplary variant polypeptides, including AG(fl) SEED (SEQ ID NO:4), AG(Q) SEED (SEQ ID NO:5), GA(fl) SEED (SEQ ID NO:7), GA(S) SEED (SEQ ID NO:8), and GA(B) SEED (SEQ ID NO:9) are shown in the following alignments.
- EXAMPLE 1 Identifying homologous structures to become parents of a SEED.
- the goal is to produce two distinct CH3-homolog
- the first task is to identify two or more CH3 domains that may produce this result when they are used as parents of a pair of SEEDs.
- the CH3 homodimer forms a dimerization interface between D sheets. It is important to find two CH3 domains that have significant differences in this interface, in order to make an effective pair of SEEDs that will preferentially heterodimerize.
- CH3 domains from IgG are structurally highly conserved across the animal kingdom, containing a classic immunoglobulin domain D -sandwich fold. While there are significant differences between species in the identities of the amino acids found on the outer surface, the dimerization interface surface that is buried upon dimerization is mostly conserved.
- Each different class of immunoglobulin has its own Fc, and in particular has its own equivalent of the IgG CH3 sequence and structure.
- Examination of the CH3 domain in the crystal structure of the Fc portion of a human IgAl revealed that the overall fold was homologous to human IgG CH3.
- the backbone RMSD root mean square deviation of the alignment of single CH3 domains from the IgA Fc 1OWO and from the IgG Fc 1L6X, excluding turns where alignment had different lengths, was about 0.99 A. (See table 2).
- the CH3 homodimer interface of IgAl is significantly different than that of IgGl.
- two SEEDs made from the CH3 of human IgAl and the CH3 of human IgGl each contain some portion of the interface from IgAl, and some from IgGl, and are designed to not dimerize with themselves, nor with either parent CH3, but to dimerize preferentially with the other complementary SEED.
- IgGl PDB entries 1DN2 (resolution 2.7A) and 1L6X (CH3 sequence highly homologous to 1DN2, with two minor differences, resolution 1.65 A), and IgAl PDB entry 1OWO (resolution 3.1 A) were used.
- FIG. 2 shows the structural alignment of the two sequences.
- the CH3 domain of IgGl is numbered according to Kabat EU Index (Kabat et al, (1991) Sequences of Proteins of Immunological Interest, 5 th Edition, NIH Publication 91-3242), while the CH3 domain of IgA is sequentially numbered as in the PDB structure 1OWO.
- Bold letters designate the backbone positions that were included in the alignment described in Table 2, which were further used to design junctional crossover points in designing SEEDs.
- the CH3 homodimer has 180° rotational symmetry around an axis that runs between the domains approximately perpendicular to the beta strands (FIG. 4). Each domain has the N- terminus and C-terminus on opposite sides of the axis of symmetry. Therefore, CH3 domains dimerize in a hand-shaking manner, where only in a line down the center of the interface along the symmetry axis do residues on one side contact the same residue in the other partner. Residues on either side of that line contact the partner domain in opposite fashion: e.g., residues on the N-terminal side of the first domain make contact with residues in the second domain that are on the C-terminal side, and vice versa.
- a CH3-based SEED is designed to break the symmetry, making the two sides different. For example, strand exchange will make one side of the dimer more like IgAl, and the other side more like IgG.
- This approach creates two different CH3 -based SEEDs that are approximately complementary in their use of IgG and IgA-derived amino acids.
- the linear polypeptide sequence runs back and forth between IgG and IgA sequences in order to make one physical side of the dimeric structure IgA-like and the other side IgG-like.
- each final SEED sequence contains multiple exchange points, at each of which the linear sequence changes from IgA to IgG or from IgG to IgA (FIGs. 3A and 3B).
- FIGs. 3A and 3B show the sequence alignment with the exchange points highlighted in bold letters.
- FIGs. 5 and 6A-C show the molecular structure illustrating the 3-dimensional locations of the exchange points.
- the simplest way to make a "Full" SEED would be to use pure IgA sequence on the first side of the exchange point, and pure IgGl sequence on the second side of the exchange point. If the exchange point is properly chosen, this would result in a SEED that should fold properly and would have an IgAl -like dimerizing surface on one side (e.g., approximately half) of the domain, and an IgG- like dimerizing surface on the other side.
- a 'mirror image' SEED can be made similarly, in which the first side is composed of IgGl sequence and the second side is composed of IgA sequence.
- heterodimers When these two SEEDs are expressed together, they will preferentially form heterodimers because only in the heterodimer will each surface be contacting a surface on the other domain that matches its class: that is, the first half of the first SEED, which is IgAl -like, will contact the second half of the second SEED, which is also IgAl -like, while the second half of the first SEED, which is IgGl -like, will contact the first half of the second SEED, which is also IgGl -like. Since both sides of the contact surface are highly complementary, the association should be strong.
- each half of the dimerization surface will contact a surface on the partner SEED that comes from a different class: that is, the first half of one SEED, which is IgA-like, will contact the second half of the partner domain, which is IgG-like; and the second half of the first SEED, which is IgGl -like, will contact the first half of the partner domain, which is IgA-like. Since these surfaces are not highly complementary, their affinity will be diminished, resulting in thermodynamics favoring the formation of fewer homodimers and more heterodimers.
- the CH3 is the only part of the Fc or antibody that was altered.
- the rest of the Fc or immunoglobulin is from human IgGl .
- Altering the amino acid sequence where the CH3 contacts or interacts with CH2 could potentially create problems with the interface between the CH3 SEEDs and the IgGl CH2 domains.
- this interface contains the binding site for FcRn, which confers important properties to the Fc that are desirable to retain. Therefore, structural information (Martin et al. (2001) Molec. Cell 7:867) was used to identify the CH3 residues involved in the interactions between CH3 and CH2, and between Fc and FcRn. Human IgGl sequences were used for those residues in all SEEDs.
- FIG. 3B has the "Full" SEED sequences aligned with the IgGl and IgA sequences in structural alignment. Residues that reside at the exchange points are highlighted in bold. Residues that were unaltered due to their importance in maintaining the interaction with C H 2 and/or with FcRn are underlined.
- EXAMPLE 4 Construction of heterodimeric Fc and antibody molecules containing CH3- based SEEDs
- Exemplary expression plasmids are, for example, pdCs-huFc-IL2 (see, for example, Lo et al, Protein Engineering [1998] 11:495), or pdHL7-KS-IL2 ⁇ see, for example US Patent 6,696,517).
- the Ngo MIV site lies within the intron sequence immediately 5' of the exon encoding IgGl CH3, and the Sma I site lies in a sequence encoding SeI 444 PrO 445 GIy 446 near the C-terminus of IgGl (Kabat EU Index).
- An exemplary DNA sequence of a mature human IgGl Fc expressed from a pdCs vector is shown in SEQ ED NO:27.
- CH3 SEEDs of the invention For example, DNA molecules with following sequences as shown in SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ DD NO:31, SEQ ID NO:32, and SEQ ID NO:53 were synthesized de novo and propagated in a pUC -derived carrier plasmid (Blue Heron Biotechnology, Bothell, WA).
- DNA fragment Ngo MIV / Sma I containing sequence encoding AG(sO) SEED (underlined corresponding to Figure 3 A, "Surface AG SEED"): gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctctgtccctacaGGGCAG CCCTTCGAACCAGAGGTCCACACCCTGCCCCCATCACGGGAGGAGATGACCAAGAACCAGGTCAG CCTGACCTGCCTGGTCCGCGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGGC AGCCGGAGAACAACTACAAGACCACGCCTTCCCGGCTGGAGCCCAGCCAGGGCACCACCACCTTC GCTGTGACCTCGAAGCTCACCGTGGACAAGAGCAGATGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGtccccggg
- DNA fragment Ngo MIV / Sma I containing sequence encoding GA(s0) SEED (underlined corresponding to Figure 3A, "Surface GA SEED"): gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctctgtccctacaGGGCAG CCCCGAGAACCACAGGTGTACACCCTGCCCCCACCGTCGGAGGAGCTGGCCCTGAACAACCAGGT GACGCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATG GGCAGCCGGAGCCCCGCGAGAAGTACCTGACTTGGGCACCCGTGCTGGACTCCGACGGCTCCTTC TTCCTCTATTCGATACTGCGCGTGGACGCAAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGtccccggg
- apolypeptide containing GA(f3) SEED maybe encoded by the followingDNA sequence: SEQ ID NO:54
- DNA fragment Ngo MIV / Sma I containing sequence encoding GA( ⁇ ) SEED (underlined): gccggctcggcccaccctctgccctgagagtgaccgctgtaccaacctctgtccctacaGGGCAG CCCCGAGAACCACAGGTGTACACCCTGCCCCCACCGTCGGAGGAGCTGGCCCTGAACGAGCaGGT GACGCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGCTGCAGGGGT CCCAGGAGCTGCCCCGCGAGAAGTACCTGACTTGGaCcCCCGTGaccGACTCCGACGGCTCCgac TTCCTCTATAGTATACTGCGCGTGaCAGCCGAtGACTGGAAGAAGGGGGACACCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCGACCGCtCCCcggg [0105]
- the gel purified Ngo MIV / Sma I fragments were then ligated to a similarly treated pdCs vector containing either an Fc moiety or an Fc-IL2 moiety, or alternatively, to a similarly treated pdHL vector containing either a DI-KS or a DI-KS-IL2 moiety.
- pdCs-HuFc(AG(f0))-IL2 containing the Ngo MIV / Sma I fragment for AG(fO) SEED (SEQ ID NO:28), and pdCs-HuFc(GA(f0)), containing the Ngo MIV / Sma I fragment for GA(fD) SEED (SEQ ID NO:30), were obtained.
- pdCs-HuFc(AG(fO))-IL2 and pdCs-HuFc(GA(fO)) encode an Fc(AG(f0)
- Fc(AG(f ⁇ ) SEED)-IL-2 polypeptide chain and an Fc(GA(f0) SEED) polypeptide chain, respectively.
- Exemplary sequences of Fc(AG(f ⁇ ) SEED)-IL-2 and of Fc(GA(flD) SEED) are shown as SEQ ID NO:33 and SEQ ID NO:34, respectively, below.
- a diagram of the resulting heterodimeric protein is shown in Figure 1 IA. To obtain simultaneous expression of both polypeptide chains from a host cell, the transcription units for these Fc polypeptides were combined on a single expression vector as described below in Example 5.
- pdHL- DI-KS(AG(fO))-IL2 and pdHL-DI-KS(GA(fD)) encode DI-KS(AG(f ⁇ ) SEED)-IL-2 heavy chain (SEQ ID NO:35), DI-KS(GA(fO) SEED) heavy chain (SEQ ID NO:36), respectively. Both expression vectors also encode the DI-KS light chain (SEQ ID NO:37).
- a construct was prepared essentially as follows: an approximately 3.9 kb Sal I / Mfe I fragment containing the sequence encoding KS(AG(f0) SEED)-IL-2 was excised from the pdHL-10 expression construct (pdHL-10 is a later generation pdHL expression vector containing a single Sal I site outside of the transcription unit) and ligated into a Sal I / Bam HI digested pBS plasmid, together with a Bam HI / Mfe I duplex linker fragment.
- This duplex linker fragment is composed of Oligol 1 (SEQ ID NO:38) and Oligol2 (SEQ ID NO:39) and contains an internal Sal I site.
- the 3.9 kb fragment was then excised from pB S as a Sal I fragment and inserted into the unique Sal I site of a pdHL-10 expression construct already containing the transcription units encoding DI-KS(GA(f0) SEED) heavy chain and the DI-KS light chain.
- CH3 dimerization is an important step in nucleating the formation of Fc and immunoglobulin heavy chain dimers.
- a and B two distinct Fc moieties containing CH3 domains
- they could pair and form Fc dimeric molecules in the following configurations: A:A, A:B, and B:B.
- the CH3 domains and hinge domains are identical, the configurations A:A, A:B, and B:B are expected to occur in a 1:2:1 ratio if A and B are expressed in equal amounts.
- the ratio [A-B] / 2*[A]*[B] is greater than 2, and preferably greater than 3, and more preferably greater than 5.
- the constructs were prepared as follows: The gene for HuFc was excised from a vector containing an Fc moiety (see, for example, Lo et al., Protein Engineering [1998] 11 :495) by enzymatic restriction at a 5' Xbal site and a 3' Xhol site. The 1.4 Kb fragment containing the HuFc gene was gel purified and subcloned into a second vector, pdCS-MuFc-KS-kappa, replacing its muFc with HuFc. The HuFc gene was flanked by two Sail sites outside the promoter region.
- a third vector containing a gene coding for HuFc-IL-2 and a single Sail site was chosen to receive the HuFc gene.
- the vector was cut with Sail, treated with Calf Intestinal Phosphatase (CIP) and gel purified.
- CIP Calf Intestinal Phosphatase
- the second vector was digested with Sail and a 2.5 Kb fragment was gel purified. This fragment contained the HuFc gene and a promoter, and was inserted into the gel-purified third vector.
- the final resulting vector contained two different transcription units with duplicated versions of the same regulatory elements, one transcription unit controlling the expression of wild type HuFc and the other controlling the expression of wild type HuFc-IL-2. Expression constructs containing SEED-based HuFc and SEED-based HuFc-IL-2 were similarly made. [0111 ] This final vector was expanded using Qiagen maxi-prep. 10 mg of the
- DNA was used to transiently transfect baby hamster kidney (BHK) cells, using the Lipofectamine TM2000 kit (Invitrogen). Cells were split, half grown in regular medium, the other half in serum-free medium, for two days. Supernatants (e.g., 100 ⁇ l) were harvested. 10 microliters of protein- A beads were added and mixed overnight at 4 0 C to bind the protein. After washing 3x with PBS containing 1% Triton-XlOO, samples were loaded onto Nu-Page (Invitrogen) 4-12% gradient Bis-Tris gels, under both reducing and non-reducing conditions. Gels were stained with colloidal blue (Invitrogen) for direct protein visualization.
- Nu-Page Invitrogen
- the reducing gel in Figure 12C shows the ratio of HuFc and HuFc-IL-2 subunits.
- the non-reducing gel in Figure 12B shows that the HuFc and HuFc-IL2 molecules dimerize randomly, with no preference for heterodimerization as compared to homodimerization.
- EXAMPLE 6 Construction, expression, and heterodimerization properties of SEED molecules with reduced immunogenicity.
- AG and GA SEED protein sequences are hybrids between two different naturally occurring human sequences, these sequences include peptide segments that are not found in normal human proteins and that may be processed into non-self MHC Class II T cell epitopes. Therefore, the following sequences were designed to reduce the number of potential non-self T-cell epitopes in the AG SEED and GA SEED sequences, depicted by the polypeptide sequence shown in SEQ ID NO: 1 and SEQ ID NO:2, respectively, wherein Xi, X 2 , X 3 , X 4 , X 5 , or X 6 may be any amino acid.
- Xi is S
- X 2 is V or T
- X 3 is S
- X is Q
- X 2 is A or T
- X 3 is L
- X 4 is F, A, D, E, G, H, K, N, P, Q, R, S, or T
- X 5 is T
- X 6 is D.
- GQPREPQVYTLPPPSEELALNEX I VTLTCLVKGFYPSDIAVEWLQGSQELPREKYLTWX 2 PVX 1 DS DGSX 4 FLYSILRVX 5 AX 6 DWKKGDTFSCSVMHEALHNHYTQKSLDR
- GA(fl) SEED (SEQ ID NO:7) was made by de novo synthesis and was introduced into the pdCs expression vector as described in Example 4, producing the polypeptide Fc(GA(fl) SEED).
- Oligo2 SEQ ID NO:41
- Oligo3 SEQ ID NO:42
- Oligo4 SEQ ID NO:43
- Oligol SEQ ID NO:40
- Oligo4 SEQ ID NO:43
- Oligol (SEQ ID NO:40) / OligolO (SEQ ID NO:48) and Oligo7 (SEQ ID NO:49) / Oligo9 (SEQ ID NO:50) with template carrier plasmid pUC containing the sequence shown in SEQ ID NO:32 were used in the first round of PCR reactions.
- Oligol (SEQ ID NO:40) / Oligo9 (SEQ ID NO: 50) were used in the second round of PCR reactions, generating the DNA fragment shown in SEQ ID NO:47 which was introduced into pdCs-Fc(GA(f2) SEED). All the sequences referred to above are shown below.
- Oligo2 (SEQ ID NO:41) CGGCGATGTCGCTGGGATAGAA
- Oligo7 (SEQ ID NO:49) CCTGACTTGGGCACCCGTGGACGACTCCGACGGCTCCCACTTCCTCTATA
- Fc(G A(f2) SEED)-IL2 sequences were expressed individually and in combinations in HEK 293T cells, and the resulting secreted proteins were partially purified based on Fc binding to Staphylococcus A protein and characterized by SDS-PAGE.
- Fc(AG(fl) SEED) and Fc(AG(f2) SEED) proteins were expressed very poorly by themselves, which is similar to the parent Fc(AG(fD) SEED) protein.
- the poor expression most likely results from the proteolysis of the monomelic protein that has no dimerization partner.
- the Fc(GA(fl) SEED)-IL2 protein was expressed at high level, while the Fc(G A(f2) SEED)-IL2 protein, differing by the additional amino acid substitution Val75Thr, was expressed at a very low level. Again, without wishing to be bound by theory, the poor expression may result from the proteolysis of the monomelic protein that has no dimerization partner.
- EXAMPLE 7 Expression of an antibody-cytokine fusion protein usiriR SEED Fc regions.
- FIG. 1 IB A diagram of this protein is shown in Figure 1 IB. Specifically, the protein contained antibody V regions that bind to EpCAM and that have the sequences as described in US Patent 6,696,517, human IgGl CHl and CH2 domains, human Ckappa, the GA and AG SEED domains, and human IL-2 fused to the C-terminus of the AG SEED-containing heavy chain.
- the protein was expressed in mammalian cells according to standard techniques producing a protein with the polypeptide chains shown in SEQ ID NO:37, SEQ ED NO:36, and SEQ ID NO:35.
- the resulting protein was characterized to determine the extent to which heterodimeric forms were secreted from the mammalian cells.
- the secreted protein was characterized by non-reducing SDS-polyacrylamide gel electrophoresis.
- three bands might be identified, corresponding to antibodies with no, one or two IL-2 moieties.
- the actual non-reducing gel showed predominantly a single band with a molecular weight corresponding to an antibody with a single IL-2 moiety. A much less intense band with a molecular weight corresponding to no IL-2 moieties was seen, and a band with a molecular weight corresponding to two IL-2 moieties was not detectable.
- approximately equal amounts of protein corresponding to antibody heavy chain and heavy chain- IL2 were detected.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Life Sciences & Earth Sciences (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
Description
Claims
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2009501919A JP5474531B2 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
CA2646965A CA2646965C (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
PL07723539T PL1999154T3 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
DK07723539T DK1999154T3 (en) | 2006-03-24 | 2007-03-23 | MANUFACTURED HETERODIMERED PROTEIN DOMAINS |
EP20070723539 EP1999154B1 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
AU2007229698A AU2007229698B9 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
ES07723539T ES2395969T3 (en) | 2006-03-24 | 2007-03-23 | Genetically modified heterodimeric protein domains |
SI200731095T SI1999154T1 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
IL194145A IL194145A (en) | 2006-03-24 | 2008-09-16 | Engineered heterodimeric protein domains |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US78547406P | 2006-03-24 | 2006-03-24 | |
US60/785,474 | 2006-03-24 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2007110205A2 true WO2007110205A2 (en) | 2007-10-04 |
WO2007110205A3 WO2007110205A3 (en) | 2008-02-28 |
Family
ID=38541456
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2007/002590 WO2007110205A2 (en) | 2006-03-24 | 2007-03-23 | Engineered heterodimeric protein domains |
Country Status (13)
Country | Link |
---|---|
US (4) | US8871912B2 (en) |
EP (1) | EP1999154B1 (en) |
JP (3) | JP5474531B2 (en) |
AR (1) | AR060070A1 (en) |
AU (1) | AU2007229698B9 (en) |
CA (1) | CA2646965C (en) |
DK (1) | DK1999154T3 (en) |
ES (1) | ES2395969T3 (en) |
IL (1) | IL194145A (en) |
PL (1) | PL1999154T3 (en) |
PT (1) | PT1999154E (en) |
SI (1) | SI1999154T1 (en) |
WO (1) | WO2007110205A2 (en) |
Cited By (395)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009089004A1 (en) * | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
WO2010112193A1 (en) * | 2009-04-02 | 2010-10-07 | Roche Glycart Ag | Multispecific antibodies comprising full length antibodies and single chain fab fragments |
WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
EP2424567A2 (en) * | 2009-04-27 | 2012-03-07 | OncoMed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
WO2012131555A2 (en) | 2011-03-25 | 2012-10-04 | Glenmark Pharmaceuticals S.A. | Hetero-dimeric immunoglobulins |
WO2012142515A2 (en) | 2011-04-13 | 2012-10-18 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
WO2012143524A2 (en) | 2011-04-20 | 2012-10-26 | Genmab A/S | Bispecific antibodies against her2 and cd3 |
WO2013004842A2 (en) | 2011-07-06 | 2013-01-10 | Genmab A/S | Antibody variants and uses thereof |
WO2013060867A2 (en) | 2011-10-27 | 2013-05-02 | Genmab A/S | Production of heterodimeric proteins |
WO2013070565A1 (en) | 2011-11-07 | 2013-05-16 | Medimmune, Llc | Multispecific and multivalent binding proteins and uses thereof |
WO2013096291A2 (en) | 2011-12-20 | 2013-06-27 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
EP2635607A1 (en) * | 2010-11-05 | 2013-09-11 | Zymeworks, Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
EP2638073A2 (en) * | 2010-11-09 | 2013-09-18 | Altimab Therapeutics, Inc. | Protein complexes for antigen binding and methods of use |
WO2013157953A1 (en) | 2012-04-20 | 2013-10-24 | Merus B.V. | Methods and means for the production of ig-like molecules |
WO2014006217A1 (en) | 2012-07-06 | 2014-01-09 | Genmab B.V. | Dimeric protein with triple mutations |
WO2014049003A1 (en) | 2012-09-25 | 2014-04-03 | Glenmark Pharmaceuticals S.A. | Purification of hetero-dimeric immunoglobulins |
WO2014054804A1 (en) | 2012-10-05 | 2014-04-10 | 協和発酵キリン株式会社 | Heterodimeric protein composition |
WO2014108198A1 (en) | 2013-01-10 | 2014-07-17 | Genmab B.V. | Human igg1 fc region variants and uses thereof |
WO2014126871A1 (en) | 2013-02-12 | 2014-08-21 | Bristol-Myers Squibb Company | Tangential flow filtration based protein refolding methods |
WO2014126884A1 (en) | 2013-02-12 | 2014-08-21 | Bristol-Myers Squibb Company | High ph protein refolding methods |
WO2014177461A1 (en) | 2013-04-29 | 2014-11-06 | F. Hoffmann-La Roche Ag | Fcrn-binding abolished anti-igf-1r antibodies and their use in the treatment of vascular eye diseases |
WO2014177460A1 (en) | 2013-04-29 | 2014-11-06 | F. Hoffmann-La Roche Ag | Human fcrn-binding modified antibodies and methods of use |
WO2015001085A1 (en) | 2013-07-05 | 2015-01-08 | Genmab B.V. | Humanized or chimeric cd3 antibodies |
WO2015101588A1 (en) | 2014-01-06 | 2015-07-09 | F. Hoffmann-La Roche Ag | Monovalent blood brain barrier shuttle modules |
WO2015101586A1 (en) | 2014-01-03 | 2015-07-09 | F. Hoffmann-La Roche Ag | Bispecific anti-hapten/anti-blood brain barrier receptor antibodies, complexes thereof and their use as blood brain barrier shuttles |
WO2015107026A1 (en) | 2014-01-15 | 2015-07-23 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn- and maintained protein a-binding properties |
WO2015138920A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
WO2015142675A2 (en) | 2014-03-15 | 2015-09-24 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
WO2015150446A1 (en) | 2014-04-02 | 2015-10-08 | F. Hoffmann-La Roche Ag | Method for detecting multispecific antibody light chain mispairing |
WO2015150447A1 (en) | 2014-04-02 | 2015-10-08 | F. Hoffmann-La Roche Ag | Multispecific antibodies |
US9212230B2 (en) | 2007-03-29 | 2015-12-15 | Genmab A/S | Bispecific antibodies and methods for production thereof |
WO2016005593A1 (en) | 2014-07-11 | 2016-01-14 | Genmab A/S | Antibodies binding axl |
WO2016014553A1 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Sortase synthesized chimeric antigen receptors |
WO2016014565A2 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
WO2016014530A1 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Combinations of low, immune enhancing. doses of mtor inhibitors and cars |
EP2982692A1 (en) | 2014-08-04 | 2016-02-10 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
WO2016025880A1 (en) | 2014-08-14 | 2016-02-18 | Novartis Ag | Treatment of cancer using gfr alpha-4 chimeric antigen receptor |
US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
WO2016044605A1 (en) | 2014-09-17 | 2016-03-24 | Beatty, Gregory | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
US9308258B2 (en) | 2009-07-08 | 2016-04-12 | Amgen Inc. | Stable and aggregation free antibody FC molecules through CH3 domain interface engineering |
WO2016055592A1 (en) | 2014-10-09 | 2016-04-14 | Engmab Ag | Bispecific antibodies against cd3epsilon and ror1 |
WO2016061142A1 (en) | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
EP3023437A1 (en) | 2014-11-20 | 2016-05-25 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
WO2016087650A1 (en) * | 2014-12-05 | 2016-06-09 | Merck Patent Gmbh | Domain-exchanged antibody |
WO2016090034A2 (en) | 2014-12-03 | 2016-06-09 | Novartis Ag | Methods for b cell preconditioning in car therapy |
WO2016164731A2 (en) | 2015-04-08 | 2016-10-13 | Novartis Ag | Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car) - expressing cell |
WO2016172583A1 (en) | 2015-04-23 | 2016-10-27 | Novartis Ag | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
US9499634B2 (en) | 2012-06-25 | 2016-11-22 | Zymeworks Inc. | Process and methods for efficient manufacturing of highly pure asymmetric antibodies in mammalian cells |
WO2017005649A1 (en) | 2015-07-09 | 2017-01-12 | Genmab A/S | Bispecific and multispecific antibodies and method for isolation of such |
WO2017009258A1 (en) | 2015-07-10 | 2017-01-19 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
WO2017019897A1 (en) | 2015-07-29 | 2017-02-02 | Novartis Ag | Combination therapies comprising antibody molecules to tim-3 |
WO2017019846A1 (en) | 2015-07-30 | 2017-02-02 | Macrogenics, Inc. | Pd-1-binding molecules and methods use thereof |
WO2017019894A1 (en) | 2015-07-29 | 2017-02-02 | Novartis Ag | Combination therapies comprising antibody molecules to lag-3 |
US9574010B2 (en) | 2011-11-04 | 2017-02-21 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the Fc domain |
US9605084B2 (en) | 2013-03-15 | 2017-03-28 | Xencor, Inc. | Heterodimeric proteins |
US9605061B2 (en) | 2010-07-29 | 2017-03-28 | Xencor, Inc. | Antibodies with modified isoelectric points |
EP3150637A1 (en) | 2015-10-02 | 2017-04-05 | F. Hoffmann-La Roche AG | Multispecific antibodies |
WO2017055388A2 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules |
WO2017055395A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xrob04 bispecific t cell activating antigen binding molecules |
WO2017055399A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Cellular based fret assay for the determination of simultaneous binding |
WO2017055392A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xcd44v6 bispecific t cell activating antigen binding molecules |
WO2017055389A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific anti-ceaxcd3 t cell activating antigen binding molecules |
WO2017055385A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xgd2 bispecific t cell activating antigen binding molecules |
WO2017055404A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific antibodies specific for pd1 and tim3 |
WO2017055391A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules binding mesothelin and cd3 |
WO2017055393A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xtim-3 bispecific t cell activating antigen binding molecules |
WO2017055314A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific anti-cd19xcd3 t cell activating antigen binding molecules |
WO2017072210A1 (en) | 2015-10-29 | 2017-05-04 | F. Hoffmann-La Roche Ag | Anti-variant fc-region antibodies and methods of use |
WO2017076492A1 (en) | 2015-11-03 | 2017-05-11 | Merck Patent Gmbh | Bi-specific antibodies for enhanced tumor selectivity and inhibition and uses thereof |
US9650446B2 (en) | 2013-01-14 | 2017-05-16 | Xencor, Inc. | Heterodimeric proteins |
US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
EP3178848A1 (en) | 2015-12-09 | 2017-06-14 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody for reducing formation of anti-drug antibodies |
AU2015202560B2 (en) * | 2008-01-07 | 2017-06-15 | Amgen Inc. | Method for Making Antibody Fc-Heterodimeric Molecules Using Electrostatic Steering Effects |
WO2017106061A1 (en) | 2015-12-14 | 2017-06-22 | Macrogenics, Inc. | Bispecific molecules having immunoreactivity with pd-1 and ctla-4, and methods of use thereof |
WO2017106656A1 (en) | 2015-12-17 | 2017-06-22 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
WO2017106810A2 (en) | 2015-12-17 | 2017-06-22 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
US9688758B2 (en) | 2012-02-10 | 2017-06-27 | Genentech, Inc. | Single-chain antibodies and other heteromultimers |
US9701759B2 (en) | 2013-01-14 | 2017-07-11 | Xencor, Inc. | Heterodimeric proteins |
WO2017125897A1 (en) | 2016-01-21 | 2017-07-27 | Novartis Ag | Multispecific molecules targeting cll-1 |
US9738722B2 (en) | 2013-01-15 | 2017-08-22 | Xencor, Inc. | Rapid clearance of antigen complexes using novel antibodies |
WO2017142928A1 (en) | 2016-02-17 | 2017-08-24 | Macrogenics, Inc. | Ror1-binding molecules, and methods of use thereof |
WO2017149515A1 (en) | 2016-03-04 | 2017-09-08 | Novartis Ag | Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore |
US9771573B2 (en) | 2012-10-03 | 2017-09-26 | Zymeworks Inc. | Methods of quantitating heavy and light chain polypeptide pairs |
WO2017165683A1 (en) | 2016-03-23 | 2017-09-28 | Novartis Ag | Cell secreted minibodies and uses thereof |
WO2017180813A1 (en) | 2016-04-15 | 2017-10-19 | Macrogenics, Inc. | Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
WO2017181119A2 (en) | 2016-04-15 | 2017-10-19 | Novartis Ag | Compositions and methods for selective protein expression |
WO2017184831A1 (en) | 2016-04-20 | 2017-10-26 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for making antibodies based on use of an expression-enhancing locus |
WO2017184832A1 (en) | 2016-04-20 | 2017-10-26 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for making antibodies based on use of expression-enhancing loci |
WO2017191101A1 (en) | 2016-05-02 | 2017-11-09 | F. Hoffmann-La Roche Ag | The contorsbody - a single chain target binder |
US9822186B2 (en) | 2014-03-28 | 2017-11-21 | Xencor, Inc. | Bispecific antibodies that bind to CD38 and CD3 |
EP3252078A1 (en) | 2016-06-02 | 2017-12-06 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
WO2017210617A2 (en) | 2016-06-02 | 2017-12-07 | Porter, David, L. | Therapeutic regimens for chimeric antigen receptor (car)- expressing cells |
US9850320B2 (en) | 2014-11-26 | 2017-12-26 | Xencor, Inc. | Heterodimeric antibodies to CD3 X CD20 |
US9856327B2 (en) | 2014-11-26 | 2018-01-02 | Xencor, Inc. | Heterodimeric antibodies to CD3 X CD123 |
WO2018007314A1 (en) | 2016-07-04 | 2018-01-11 | F. Hoffmann-La Roche Ag | Novel antibody format |
WO2018013918A2 (en) | 2016-07-15 | 2018-01-18 | Novartis Ag | Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor |
WO2018011421A1 (en) | 2016-07-14 | 2018-01-18 | Genmab A/S | Multispecific antibodies against cd40 and cd137 |
US9879095B2 (en) | 2010-08-24 | 2018-01-30 | Hoffman-La Roche Inc. | Bispecific antibodies comprising a disulfide stabilized-Fv fragment |
US9879084B2 (en) | 2011-09-23 | 2018-01-30 | Oncomed Pharmaceuticals, Inc. | Modified immunoglobulin molecules that specifically bind human VEGF and DLL4 |
WO2018023025A1 (en) | 2016-07-28 | 2018-02-01 | Novartis Ag | Combination therapies of chimeric antigen receptors adn pd-1 inhibitors |
WO2018026819A2 (en) | 2016-08-01 | 2018-02-08 | Novartis Ag | Treatment of cancer using a chimeric antigen receptor in combination with an inhibitor of a pro-m2 macrophage molecule |
US9890204B2 (en) | 2009-04-07 | 2018-02-13 | Hoffmann-La Roche Inc. | Trivalent, bispecific antibodies |
US9914777B2 (en) | 2015-07-10 | 2018-03-13 | Merus N.V. | Human CD3 binding antibody |
US9914785B2 (en) | 2012-11-28 | 2018-03-13 | Zymeworks Inc. | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
US9914776B2 (en) | 2014-08-04 | 2018-03-13 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
WO2018050733A1 (en) | 2016-09-14 | 2018-03-22 | Merck Patent Gmbh | Anti-c-met antibodies and antibody drug conjugates thereof for efficient tumor inhibition |
WO2018054940A1 (en) | 2016-09-20 | 2018-03-29 | Merck Patent Gmbh | Diagnostic anti-pd-l1 antibody and use thereof |
WO2018060301A1 (en) | 2016-09-30 | 2018-04-05 | F. Hoffmann-La Roche Ag | Bispecific antibodies against cd3 |
WO2018060035A1 (en) | 2016-09-30 | 2018-04-05 | F. Hoffmann-La Roche Ag | Spr-based dual-binding assay for the functional analysis of multispecific molecules |
WO2018067992A1 (en) | 2016-10-07 | 2018-04-12 | Novartis Ag | Chimeric antigen receptors for the treatment of cancer |
WO2018083126A1 (en) | 2016-11-01 | 2018-05-11 | Genmab B.V. | Polypeptide variants and uses thereof |
US9982036B2 (en) | 2011-02-28 | 2018-05-29 | Hoffmann-La Roche Inc. | Dual FC antigen binding proteins |
US9994646B2 (en) | 2009-09-16 | 2018-06-12 | Genentech, Inc. | Coiled coil and/or tether containing protein complexes and uses thereof |
US10011858B2 (en) | 2005-03-31 | 2018-07-03 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
WO2018141894A1 (en) | 2017-02-02 | 2018-08-09 | Merck Patent Gmbh | Preferred pairing of antibody domains |
WO2018146317A1 (en) | 2017-02-10 | 2018-08-16 | Genmab B.V. | Polypeptide variants and uses thereof |
WO2018155611A1 (en) | 2017-02-24 | 2018-08-30 | 中外製薬株式会社 | Pharmaceutical composition, antigen-binding molecules, treatment method, and screening method |
WO2018158719A1 (en) | 2017-03-02 | 2018-09-07 | Novartis Ag | Engineered heterodimeric proteins |
WO2018162749A1 (en) | 2017-03-09 | 2018-09-13 | Genmab A/S | Antibodies against pd-l1 |
WO2018162517A1 (en) | 2017-03-10 | 2018-09-13 | F. Hoffmann-La Roche Ag | Method for producing multispecific antibodies |
US10077298B2 (en) | 2012-11-28 | 2018-09-18 | Zymeworks Inc. | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
US10087250B2 (en) | 2012-10-08 | 2018-10-02 | Roche Glycart Ag | Fc-free antibodies comprising two fab-fragments and methods of use |
WO2018178396A1 (en) | 2017-03-31 | 2018-10-04 | Genmab Holding B.V. | Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof |
WO2018184964A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Immunoconjugates of an anti-pd-1 antibody with a mutant il-2 or with il-15 |
WO2018184965A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Immunoconjugates of il-2 with an anti-pd-1 and tim-3 bispecific antibody |
WO2018184966A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Antibodies binding to steap-1 |
WO2018185043A1 (en) | 2017-04-05 | 2018-10-11 | F. Hoffmann-La Roche Ag | Bispecific antibodies specifically binding to pd1 and lag3 |
WO2018187227A1 (en) | 2017-04-03 | 2018-10-11 | Concologie, Inc. | Methods for treating cancer using ps-targeting antibodies with immuno-oncology agents |
WO2018189220A1 (en) | 2017-04-13 | 2018-10-18 | F. Hoffmann-La Roche Ag | An interleukin-2 immunoconjugate, a cd40 agonist, and optionally a pd-1 axis binding antagonist for use in methods of treating cancer |
US10106612B2 (en) | 2012-06-27 | 2018-10-23 | Hoffmann-La Roche Inc. | Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof |
US10106624B2 (en) | 2013-03-15 | 2018-10-23 | Xencor, Inc. | Heterodimeric proteins |
US10106600B2 (en) | 2010-03-26 | 2018-10-23 | Roche Glycart Ag | Bispecific antibodies |
WO2018201051A1 (en) | 2017-04-28 | 2018-11-01 | Novartis Ag | Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor |
WO2018201056A1 (en) | 2017-04-28 | 2018-11-01 | Novartis Ag | Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor |
US10131710B2 (en) | 2013-01-14 | 2018-11-20 | Xencor, Inc. | Optimized antibody variable regions |
US10138293B2 (en) | 2007-12-21 | 2018-11-27 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
WO2018220099A1 (en) | 2017-06-02 | 2018-12-06 | F. Hoffmann-La Roche Ag | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
WO2018224609A1 (en) | 2017-06-07 | 2018-12-13 | Genmab B.V. | Therapeutic antibodies based on mutated igg hexamers |
US10155815B2 (en) | 2013-02-26 | 2018-12-18 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
WO2018234575A1 (en) | 2017-06-22 | 2018-12-27 | Kymab Limited | Bispecific antibodies for factor ix and factor x |
WO2018237157A1 (en) | 2017-06-22 | 2018-12-27 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
WO2019006007A1 (en) | 2017-06-27 | 2019-01-03 | Novartis Ag | Dosage regimens for anti-tim-3 antibodies and uses thereof |
US10174124B2 (en) | 2013-12-17 | 2019-01-08 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
WO2019014091A1 (en) | 2017-07-10 | 2019-01-17 | Eli Lilly And Company | Checkpoint inhibitor bispecific antibodies |
WO2019018730A1 (en) | 2017-07-20 | 2019-01-24 | Novartis Ag | Dosage regimens of anti-lag-3 antibodies and uses thereof |
WO2019025545A1 (en) | 2017-08-04 | 2019-02-07 | Genmab A/S | Binding agents binding to pd-l1 and cd137 and use thereof |
US10227410B2 (en) | 2015-12-07 | 2019-03-12 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and PSMA |
US10227411B2 (en) | 2015-03-05 | 2019-03-12 | Xencor, Inc. | Modulation of T cells with bispecific antibodies and FC fusions |
US10251952B2 (en) | 2014-06-26 | 2019-04-09 | Hoffmann-La Roche Inc. | Humanized anti-tau(pS422) antibody brain shuttles and use thereof |
WO2019077092A1 (en) | 2017-10-20 | 2019-04-25 | F. Hoffmann-La Roche Ag | Method for generating multispecific antibodies from monospecific antibodies |
WO2019086395A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Trifab-contorsbody |
WO2019086362A1 (en) | 2017-10-30 | 2019-05-09 | F. Hoffmann-La Roche Ag | Method for in vivo generation of multispecific antibodies from monospecific antibodies |
WO2019086394A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | The compbody - a multivalent target binder |
WO2019086500A2 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Bispecific 2+1 contorsbodies |
WO2019086499A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Novel tnf family ligand trimer-containing antigen binding molecules |
EP2787078B1 (en) * | 2011-10-31 | 2019-05-22 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule having regulated conjugation between heavy-chain and light-chain |
WO2019099838A1 (en) | 2017-11-16 | 2019-05-23 | Novartis Ag | Combination therapies |
US10316088B2 (en) | 2016-06-28 | 2019-06-11 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
US10323099B2 (en) | 2013-10-11 | 2019-06-18 | Hoffmann-La Roche Inc. | Multispecific domain exchanged common variable light chain antibodies |
US10323094B2 (en) | 2015-06-16 | 2019-06-18 | Genentech, Inc. | Humanized and affinity matured antibodies to FcRH5 and methods of use |
WO2019122054A1 (en) | 2017-12-22 | 2019-06-27 | F. Hoffmann-La Roche Ag | Depletion of light chain mispaired antibody variants by hydrophobic interaction chromatography |
WO2019122052A2 (en) | 2017-12-21 | 2019-06-27 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/wt1 |
EP3514179A1 (en) | 2014-01-24 | 2019-07-24 | Dana-Farber Cancer Institute, Inc. | Antibody molecules to pd-1 and uses thereof |
WO2019145455A1 (en) | 2018-01-24 | 2019-08-01 | Genmab B.V. | Polypeptide variants and uses thereof |
WO2019152660A1 (en) | 2018-01-31 | 2019-08-08 | Novartis Ag | Combination therapy using a chimeric antigen receptor |
WO2019154890A1 (en) | 2018-02-09 | 2019-08-15 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2019154776A1 (en) | 2018-02-06 | 2019-08-15 | F. Hoffmann-La Roche Ag | Treatment of ophthalmologic diseases |
WO2019160007A1 (en) | 2018-02-14 | 2019-08-22 | 中外製薬株式会社 | Antigen-binding molecule and combination |
WO2019175198A2 (en) | 2018-03-12 | 2019-09-19 | Genmab A/S | Antibodies |
US10428155B2 (en) | 2014-12-22 | 2019-10-01 | Xencor, Inc. | Trispecific antibodies |
WO2019200229A1 (en) | 2018-04-13 | 2019-10-17 | Novartis Ag | Dosage regimens for anti-pd-l1 antibodies and uses thereof |
WO2019202041A1 (en) | 2018-04-18 | 2019-10-24 | F. Hoffmann-La Roche Ag | Multispecific antibodies and use thereof |
WO2019210153A1 (en) | 2018-04-27 | 2019-10-31 | Novartis Ag | Car t cell therapies with enhanced efficacy |
US10465000B2 (en) | 2013-12-20 | 2019-11-05 | Hoffmann-La Roche Inc. | Humanized anti-Tau(pS422) antibodies and methods of use |
WO2019211472A1 (en) | 2018-05-03 | 2019-11-07 | Genmab B.V. | Antibody variant combinations and uses thereof |
US10487155B2 (en) | 2013-01-14 | 2019-11-26 | Xencor, Inc. | Heterodimeric proteins |
WO2019227003A1 (en) | 2018-05-25 | 2019-11-28 | Novartis Ag | Combination therapy with chimeric antigen receptor (car) therapies |
WO2019226617A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Compositions and methods for enhancing the killing of target cells by nk cells |
WO2019226658A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Multispecific antigen-binding compositions and methods of use |
WO2019232244A2 (en) | 2018-05-31 | 2019-12-05 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
US10501545B2 (en) | 2015-06-16 | 2019-12-10 | Genentech, Inc. | Anti-CLL-1 antibodies and methods of use |
US10501543B2 (en) | 2016-10-14 | 2019-12-10 | Xencor, Inc. | IL15/IL15Rα heterodimeric Fc-fusion proteins |
USRE47770E1 (en) | 2002-07-18 | 2019-12-17 | Merus N.V. | Recombinant production of mixtures of antibodies |
WO2019241426A1 (en) | 2018-06-13 | 2019-12-19 | Novartis Ag | Bcma chimeric antigen receptors and uses thereof |
WO2019246293A2 (en) | 2018-06-19 | 2019-12-26 | Atarga, Llc | Antibody molecules to complement component 5 and uses thereof |
WO2019243636A1 (en) | 2018-06-22 | 2019-12-26 | Genmab Holding B.V. | Anti-cd37 antibodies and anti-cd20 antibodies, compositions and methods of use thereof |
US10519242B2 (en) | 2013-03-15 | 2019-12-31 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
US10526417B2 (en) | 2014-11-26 | 2020-01-07 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CD38 |
WO2020012036A1 (en) | 2018-07-13 | 2020-01-16 | Genmab A/S | Variants of cd38 antibody and uses thereof |
WO2020012038A1 (en) | 2018-07-13 | 2020-01-16 | Genmab A/S | Trogocytosis-mediated therapy using cd38 antibodies |
WO2020012337A1 (en) | 2018-07-10 | 2020-01-16 | Novartis Ag | 3-(5-amino-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and their use in the treatment of i karos family zinc finger 2 (ikzf2)-dependent diseases |
US10544187B2 (en) | 2013-03-15 | 2020-01-28 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
WO2020021465A1 (en) | 2018-07-25 | 2020-01-30 | Advanced Accelerator Applications (Italy) S.R.L. | Method of treatment of neuroendocrine tumors |
EP3611188A1 (en) | 2014-11-06 | 2020-02-19 | F. Hoffmann-La Roche AG | Fc-region variants with modified fcrn-binding and methods of use |
WO2020045545A1 (en) | 2018-08-29 | 2020-03-05 | 中外製薬株式会社 | Antibody half-molecule, and method for inhibiting homodimer formation of antibody half-molecule |
WO2020049128A1 (en) | 2018-09-06 | 2020-03-12 | Kymab Limited | Antigen-binding molecules comprising unpaired variable domains |
US10596257B2 (en) | 2016-01-08 | 2020-03-24 | Hoffmann-La Roche Inc. | Methods of treating CEA-positive cancers using PD-1 axis binding antagonists and anti-CEA/anti-CD3 bispecific antibodies |
WO2020068774A1 (en) | 2018-09-24 | 2020-04-02 | The Medical College Of Wisconsin, Inc. | System and method for the development of cd30 bispecific antibodies for immunotherapy of cd30+ malignancies |
US10611825B2 (en) | 2011-02-28 | 2020-04-07 | Hoffmann La-Roche Inc. | Monovalent antigen binding proteins |
EP3632462A1 (en) | 2012-07-06 | 2020-04-08 | Genmab B.V. | Dimeric protein with triple mutations |
WO2020070313A1 (en) | 2018-10-04 | 2020-04-09 | Genmab Holding B.V. | Pharmaceutical compositions comprising bispecific anti-cd37 antibodies |
US10633457B2 (en) | 2014-12-03 | 2020-04-28 | Hoffmann-La Roche Inc. | Multispecific antibodies |
WO2020089051A1 (en) | 2018-10-29 | 2020-05-07 | F. Hoffmann-La Roche Ag | Antibody formulation |
WO2020094744A1 (en) | 2018-11-06 | 2020-05-14 | Genmab A/S | Antibody formulation |
EP3660042A1 (en) | 2014-07-31 | 2020-06-03 | Novartis AG | Subset-optimized chimeric antigen receptor-containing t-cells |
WO2020115115A1 (en) | 2018-12-05 | 2020-06-11 | Morphosys Ag | Multispecific antigen-binding molecules |
WO2020128898A1 (en) | 2018-12-20 | 2020-06-25 | Novartis Ag | Pharmaceutical combinations |
WO2020128467A2 (en) | 2018-12-19 | 2020-06-25 | Kymab Limited | Antagonists |
WO2020127619A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
WO2020128972A1 (en) | 2018-12-20 | 2020-06-25 | Novartis Ag | Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
WO2020128049A1 (en) | 2018-12-21 | 2020-06-25 | Kymab Limited | Fixaxfx bispecific antibody with common light chain |
WO2020136060A1 (en) | 2018-12-28 | 2020-07-02 | F. Hoffmann-La Roche Ag | A peptide-mhc-i-antibody fusion protein for therapeutic use in a patient with amplified immune response |
WO2020165868A1 (en) | 2019-02-15 | 2020-08-20 | Perkinelmer Cellular Technologies Germany Gmbh | Low-power microscope-objective pre-scan and high-power microscope-objective scan in x,y and z-direction for imaging objects such as cells using a microscope |
WO2020165833A1 (en) | 2019-02-15 | 2020-08-20 | Novartis Ag | 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
WO2020165834A1 (en) | 2019-02-15 | 2020-08-20 | Novartis Ag | Substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
WO2020172553A1 (en) | 2019-02-22 | 2020-08-27 | Novartis Ag | Combination therapies of egfrviii chimeric antigen receptors and pd-1 inhibitors |
US10781262B2 (en) | 2014-11-20 | 2020-09-22 | Hoffmann-La Roche Inc. | Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists |
EP3712171A1 (en) | 2014-08-19 | 2020-09-23 | Novartis AG | Treatment of cancer using a cd123 chimeric antigen receptor |
US10787518B2 (en) | 2016-06-14 | 2020-09-29 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
US10793632B2 (en) | 2016-08-30 | 2020-10-06 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
WO2020200941A1 (en) | 2019-03-29 | 2020-10-08 | F. Hoffmann-La Roche Ag | Spr-based binding assay for the functional analysis of multivalent molecules |
WO2020200944A1 (en) | 2019-03-29 | 2020-10-08 | F. Hoffmann-La Roche Ag | Method for generating avid-binding multispecific antibodies |
WO2020205523A1 (en) | 2019-03-29 | 2020-10-08 | Atarga, Llc | Anti fgf23 antibody |
EP3722316A1 (en) | 2014-07-21 | 2020-10-14 | Novartis AG | Treatment of cancer using a cd33 chimeric antigen receptor |
WO2020216879A1 (en) | 2019-04-25 | 2020-10-29 | F. Hoffmann-La Roche Ag | Therapeutic multispecific polypeptides activated by polypeptide chain exchange |
WO2020216878A1 (en) | 2019-04-25 | 2020-10-29 | F. Hoffmann-La Roche Ag | Generation of antibody-derived polypeptides by polypeptide chain exchange |
WO2020216883A1 (en) | 2019-04-25 | 2020-10-29 | F. Hoffmann-La Roche Ag | Activatable therapeutic multispecific polypeptides with extended half-life |
US10822402B2 (en) | 2015-06-24 | 2020-11-03 | Hoffmann-La Roche Inc. | Humanized anti-tau(pS422) antibodies and methods of use |
WO2020225456A1 (en) | 2019-05-09 | 2020-11-12 | Genmab B.V. | Dosage regimens for a combination of anti-dr5 antibodies for use in treating cancer |
WO2020229378A1 (en) | 2019-05-13 | 2020-11-19 | F. Hoffmann-La Roche Ag | Interference-suppressed pharmacokinetic immunoassay |
US10844127B2 (en) | 2014-02-28 | 2020-11-24 | Merus N.V. | Antibodies that bind EGFR and ErbB3 |
US10851178B2 (en) | 2011-10-10 | 2020-12-01 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
US10858417B2 (en) | 2013-03-15 | 2020-12-08 | Xencor, Inc. | Heterodimeric proteins |
US10865253B2 (en) | 2014-12-19 | 2020-12-15 | Genmab A/S | Rodent bispecific heterodimeric proteins |
WO2020254357A1 (en) | 2019-06-19 | 2020-12-24 | F. Hoffmann-La Roche Ag | Method for the generation of a protein expressing cell by targeted integration using cre mrna |
WO2020260327A1 (en) | 2019-06-26 | 2020-12-30 | F. Hoffmann-La Roche Ag | Mammalian cell lines with sirt-1 gene knockout |
WO2021001289A1 (en) | 2019-07-02 | 2021-01-07 | F. Hoffmann-La Roche Ag | Immunoconjugates comprising a mutant interleukin-2 and an anti-cd8 antibody |
WO2021009146A1 (en) | 2019-07-15 | 2021-01-21 | F. Hoffmann-La Roche Ag | Antibodies binding to nkg2d |
WO2021018859A2 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2021018925A1 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
US10934571B2 (en) | 2002-07-18 | 2021-03-02 | Merus N.V. | Recombinant production of mixtures of antibodies |
US10947319B2 (en) | 2013-11-27 | 2021-03-16 | Zymeworks Inc. | Bispecific antigen-binding constructs targeting HER2 |
US10968276B2 (en) | 2013-03-12 | 2021-04-06 | Xencor, Inc. | Optimized anti-CD3 variable regions |
US10981992B2 (en) | 2017-11-08 | 2021-04-20 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
US10982006B2 (en) | 2018-04-04 | 2021-04-20 | Xencor, Inc. | Heterodimeric antibodies that bind fibroblast activation protein |
WO2021079195A1 (en) | 2019-10-21 | 2021-04-29 | Novartis Ag | Tim-3 inhibitors and uses thereof |
WO2021079188A1 (en) | 2019-10-21 | 2021-04-29 | Novartis Ag | Combination therapies with venetoclax and tim-3 inhibitors |
WO2021089850A1 (en) | 2019-11-06 | 2021-05-14 | Genmab B.V. | Antibody variant combinations and uses thereof |
US11013801B2 (en) | 2015-12-09 | 2021-05-25 | Hoffmann-La Roche Inc. | Treatment method |
WO2021108661A2 (en) | 2019-11-26 | 2021-06-03 | Novartis Ag | Chimeric antigen receptors and uses thereof |
WO2021123996A1 (en) | 2019-12-20 | 2021-06-24 | Novartis Ag | Uses of anti-tgf-beta antibodies and checkpoint inhibitors for the treatment of proliferative diseases |
WO2021122875A1 (en) | 2019-12-18 | 2021-06-24 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/mage-a4 |
WO2021122733A1 (en) | 2019-12-18 | 2021-06-24 | F. Hoffmann-La Roche Ag | Bispecific anti-ccl2 antibodies |
US11046769B2 (en) | 2018-11-13 | 2021-06-29 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
EP3842453A1 (en) | 2014-11-06 | 2021-06-30 | F. Hoffmann-La Roche AG | Fc-region variants with modified fcrn- and protein a-binding properties |
US11053316B2 (en) | 2013-01-14 | 2021-07-06 | Xencor, Inc. | Optimized antibody variable regions |
WO2021136772A1 (en) | 2020-01-02 | 2021-07-08 | F. Hoffmann-La Roche Ag | Method for determining the amount of a therapeutic antibody in the brain |
US11066483B2 (en) | 2010-11-30 | 2021-07-20 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
WO2021144457A1 (en) | 2020-01-16 | 2021-07-22 | Genmab A/S | Formulations of cd38 antibodies and uses thereof |
WO2021146636A1 (en) | 2020-01-17 | 2021-07-22 | Becton, Dickinson And Company | Methods and compositions for single cell secretomics |
WO2021144657A1 (en) | 2020-01-17 | 2021-07-22 | Novartis Ag | Combination comprising a tim-3 inhibitor and a hypomethylating agent for use in treating myelodysplastic syndrome or chronic myelomonocytic leukemia |
US11072653B2 (en) | 2015-06-08 | 2021-07-27 | Macrogenics, Inc. | LAG-3-binding molecules and methods of use thereof |
US11084877B2 (en) | 2014-09-12 | 2021-08-10 | Genentech, Inc. | Anti-CLL-1 antibodies and immunoconjugates |
US11084863B2 (en) | 2017-06-30 | 2021-08-10 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains |
WO2021156258A1 (en) | 2020-02-04 | 2021-08-12 | BioNTech SE | Treatment involving antigen vaccination and binding agents binding to pd-l1 and cd137 |
WO2021173995A2 (en) | 2020-02-27 | 2021-09-02 | Novartis Ag | Methods of making chimeric antigen receptor-expressing cells |
EP3878866A1 (en) | 2013-04-29 | 2021-09-15 | F. Hoffmann-La Roche AG | Fc-receptor binding modified asymmetric antibodies and methods of use |
US11124576B2 (en) | 2013-09-27 | 2021-09-21 | Chungai Seiyaku Kabushiki Kaisha | Method for producing polypeptide heteromultimer |
WO2021185934A1 (en) | 2020-03-18 | 2021-09-23 | Genmab A/S | Antibodies binding to b7h4 |
WO2021190980A1 (en) | 2020-03-22 | 2021-09-30 | Quadrucept Bio Limited | Multimers for viral strain evolution |
WO2021194839A1 (en) | 2020-03-25 | 2021-09-30 | Eli Lilly And Company | Multispecific binding proteins and methods of developing the same |
US11142587B2 (en) | 2015-04-01 | 2021-10-12 | Chugai Seiyaku Kabushiki Kaisha | Method for producing polypeptide hetero-oligomer |
WO2021211753A1 (en) | 2020-04-15 | 2021-10-21 | Voyager Therapeutics, Inc. | Tau binding compounds |
WO2021209402A2 (en) | 2020-04-15 | 2021-10-21 | F. Hoffmann-La Roche Ag | Immunoconjugates |
US11161915B2 (en) | 2015-10-08 | 2021-11-02 | Zymeworks Inc. | Antigen-binding polypeptide constructs comprising kappa and lambda light chains and uses thereof |
WO2021222552A1 (en) | 2020-04-30 | 2021-11-04 | Celgene Corporation | Methods of treating cytokine-related adverse events |
US11174315B2 (en) | 2015-10-08 | 2021-11-16 | Macrogenics, Inc. | Combination therapy for the treatment of cancer |
WO2021231278A1 (en) | 2020-05-11 | 2021-11-18 | F. Hoffmann-La Roche Ag | Combination therapy with modified pbmcs and an immunoconjugate |
WO2021255155A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cd19 |
WO2021255138A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Immune activating fc domain binding molecules |
WO2021255143A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and folr1 |
WO2021255142A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
WO2021255146A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cea |
WO2021260528A1 (en) | 2020-06-23 | 2021-12-30 | Novartis Ag | Dosing regimen comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
WO2022013787A1 (en) | 2020-07-16 | 2022-01-20 | Novartis Ag | Anti-betacellulin antibodies, fragments thereof, and multi-specific binding molecules |
WO2022018294A1 (en) | 2020-07-23 | 2022-01-27 | Genmab B.V. | A combination of anti-dr5 antibodies and an immunomodulatory imide drug for use in treating multiple myeloma |
WO2022026592A2 (en) | 2020-07-28 | 2022-02-03 | Celltas Bio, Inc. | Antibody molecules to coronavirus and uses thereof |
US11242402B2 (en) | 2016-12-23 | 2022-02-08 | Macrogenics, Inc. | ADAM9-binding molecules, and methods of use thereof |
US11242390B2 (en) | 2016-03-22 | 2022-02-08 | Hoffmann-La Roche Inc. | Protease-activated T cell bispecific molecules |
WO2022029011A1 (en) | 2020-08-06 | 2022-02-10 | BioNTech SE | Binding agents for coronavirus s protein |
WO2022029573A1 (en) | 2020-08-03 | 2022-02-10 | Novartis Ag | Heteroaryl substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
WO2022043557A1 (en) | 2020-08-31 | 2022-03-03 | Advanced Accelerator Applications International Sa | Method of treating psma-expressing cancers |
WO2022043558A1 (en) | 2020-08-31 | 2022-03-03 | Advanced Accelerator Applications International Sa | Method of treating psma-expressing cancers |
WO2022049220A2 (en) | 2020-09-02 | 2022-03-10 | Genmab A/S | Antibody therapy |
US11279770B2 (en) | 2014-02-28 | 2022-03-22 | Merus N.V. | Antibody that binds ErbB-2 and ErbB-3 |
US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
WO2022063877A1 (en) | 2020-09-24 | 2022-03-31 | F. Hoffmann-La Roche Ag | Mammalian cell lines with gene knockout |
WO2022069724A1 (en) | 2020-10-02 | 2022-04-07 | Genmab A/S | Antibodies capable of binding to ror2 and bispecific antibodies binding to ror2 and cd3 |
US11306156B2 (en) | 2014-05-28 | 2022-04-19 | Zymeworks Inc. | Modified antigen binding polypeptide constructs and uses thereof |
US11312770B2 (en) | 2017-11-08 | 2022-04-26 | Xencor, Inc. | Bispecific and monospecific antibodies using novel anti-PD-1 sequences |
US11319355B2 (en) | 2017-12-19 | 2022-05-03 | Xencor, Inc. | Engineered IL-2 Fc fusion proteins |
WO2022097065A2 (en) | 2020-11-06 | 2022-05-12 | Novartis Ag | ANTIBODY Fc VARIANTS |
WO2022104061A1 (en) | 2020-11-13 | 2022-05-19 | Novartis Ag | Combination therapies with chimeric antigen receptor (car)-expressing cells |
WO2022100613A1 (en) | 2020-11-10 | 2022-05-19 | 上海齐鲁制药研究中心有限公司 | Bispecific antibody for claudin 18a2 and cd3 and application of bispecific antibody |
US11359015B2 (en) | 2015-07-15 | 2022-06-14 | Genmab A/S | Humanized or chimeric CD3 antibodies |
US11358999B2 (en) | 2018-10-03 | 2022-06-14 | Xencor, Inc. | IL-12 heterodimeric Fc-fusion proteins |
WO2022129120A1 (en) | 2020-12-17 | 2022-06-23 | F. Hoffmann-La Roche Ag | Anti-hla-g antibodies and use thereof |
WO2022129313A1 (en) | 2020-12-18 | 2022-06-23 | F. Hoffmann-La Roche Ag | Precursor proteins and kit for targeted therapy |
WO2022136140A1 (en) | 2020-12-22 | 2022-06-30 | F. Hoffmann-La Roche Ag | Oligonucleotides targeting xbp1 |
US11377477B2 (en) | 2018-10-12 | 2022-07-05 | Xencor, Inc. | PD-1 targeted IL-15/IL-15RALPHA fc fusion proteins and uses in combination therapies thereof |
WO2022148853A1 (en) | 2021-01-11 | 2022-07-14 | F. Hoffmann-La Roche Ag | Immunoconjugates |
WO2022148732A1 (en) | 2021-01-06 | 2022-07-14 | F. Hoffmann-La Roche Ag | Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody |
WO2022162569A1 (en) | 2021-01-29 | 2022-08-04 | Novartis Ag | Dosage regimes for anti-cd73 and anti-entpd2 antibodies and uses thereof |
EP4043485A1 (en) | 2017-01-26 | 2022-08-17 | Novartis AG | Cd28 compositions and methods for chimeric antigen receptor therapy |
US11421022B2 (en) | 2012-06-27 | 2022-08-23 | Hoffmann-La Roche Inc. | Method for making antibody Fc-region conjugates comprising at least one binding entity that specifically binds to a target and uses thereof |
WO2022175217A1 (en) | 2021-02-18 | 2022-08-25 | F. Hoffmann-La Roche Ag | Method for resolving complex, multistep antibody interactions |
WO2022184659A1 (en) | 2021-03-01 | 2022-09-09 | Quadrucept Bio Limited | Antibody domains & multimers |
WO2022189667A1 (en) | 2021-03-12 | 2022-09-15 | Genmab A/S | Non-activating antibody variants |
US11459404B2 (en) | 2013-02-26 | 2022-10-04 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
WO2022206872A1 (en) | 2021-03-31 | 2022-10-06 | 江苏恒瑞医药股份有限公司 | Truncated taci polypeptide and fusion protein and use thereof |
US11466094B2 (en) | 2016-11-15 | 2022-10-11 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies |
WO2022215011A1 (en) | 2021-04-07 | 2022-10-13 | Novartis Ag | USES OF ANTI-TGFβ ANTIBODIES AND OTHER THERAPEUTIC AGENTS FOR THE TREATMENT OF PROLIFERATIVE DISEASES |
US11472890B2 (en) | 2019-03-01 | 2022-10-18 | Xencor, Inc. | Heterodimeric antibodies that bind ENPP3 and CD3 |
WO2022223001A1 (en) | 2021-04-22 | 2022-10-27 | 广东菲鹏制药股份有限公司 | Bispecific multifunctional fusion polypeptide |
WO2022228705A1 (en) | 2021-04-30 | 2022-11-03 | F. Hoffmann-La Roche Ag | Dosing for combination treatment with anti-cd20/anti-cd3 bispecific antibody and anti-cd79b antibody drug conjugate |
WO2022228706A1 (en) | 2021-04-30 | 2022-11-03 | F. Hoffmann-La Roche Ag | Dosing for treatment with anti-cd20/anti-cd3 bispecific antibody |
WO2022234146A1 (en) | 2021-05-07 | 2022-11-10 | Genmab A/S | PHARMACEUTICAL COMPOSITIONS COMPRISING BISPECIFIC ANTIBODIES BINDING TO B7H4 and CD3 |
WO2022237856A1 (en) | 2021-05-12 | 2022-11-17 | 江苏恒瑞医药股份有限公司 | Antigen binding molecule specifically binding to rankl and ngf, and medical use thereof |
WO2022237882A1 (en) | 2021-05-14 | 2022-11-17 | 江苏恒瑞医药股份有限公司 | Antigen-binding molecule |
US11505595B2 (en) | 2018-04-18 | 2022-11-22 | Xencor, Inc. | TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains |
WO2022243846A1 (en) | 2021-05-18 | 2022-11-24 | Novartis Ag | Combination therapies |
US11524991B2 (en) | 2018-04-18 | 2022-12-13 | Xencor, Inc. | PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof |
WO2022263501A1 (en) | 2021-06-18 | 2022-12-22 | F. Hoffmann-La Roche Ag | Bispecific anti-ccl2 antibodies |
WO2022268740A1 (en) | 2021-06-21 | 2022-12-29 | Genmab A/S | Combination dosage regime of cd137 and pd-l1 binding agents |
WO2023279092A2 (en) | 2021-07-02 | 2023-01-05 | Genentech, Inc. | Methods and compositions for treating cancer |
WO2023284829A1 (en) | 2021-07-14 | 2023-01-19 | 江苏恒瑞医药股份有限公司 | Antigen-binding molecule specifically binding to hgfr and eger, and pharmaceutical use thereof |
WO2023001884A1 (en) | 2021-07-22 | 2023-01-26 | F. Hoffmann-La Roche Ag | Heterodimeric fc domain antibodies |
WO2023006809A1 (en) | 2021-07-27 | 2023-02-02 | Morphosys Ag | Combinations of antigen binding molecules |
WO2023010095A1 (en) | 2021-07-28 | 2023-02-02 | F. Hoffmann-La Roche Ag | Methods and compositions for treating cancer |
US11591401B2 (en) | 2020-08-19 | 2023-02-28 | Xencor, Inc. | Anti-CD28 compositions |
WO2023031473A1 (en) | 2021-09-06 | 2023-03-09 | Genmab B.V. | Antibodies capable of binding to cd27, variants thereof and uses thereof |
WO2023044483A2 (en) | 2021-09-20 | 2023-03-23 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
WO2023046071A1 (en) | 2021-09-23 | 2023-03-30 | 江苏恒瑞医药股份有限公司 | Anti-klb antibodies and uses |
US11618776B2 (en) | 2018-12-20 | 2023-04-04 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15/IL-15RA and NKG2D antigen binding domains |
US11618790B2 (en) | 2010-12-23 | 2023-04-04 | Hoffmann-La Roche Inc. | Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery |
WO2023051798A1 (en) | 2021-09-30 | 2023-04-06 | 江苏恒瑞医药股份有限公司 | Anti-il23 antibody fusion protein and uses thereof |
WO2023057571A1 (en) | 2021-10-08 | 2023-04-13 | Genmab A/S | Antibodies binding to cd30 and cd3 |
WO2023062048A1 (en) | 2021-10-14 | 2023-04-20 | F. Hoffmann-La Roche Ag | Alternative pd1-il7v immunoconjugates for the treatment of cancer |
WO2023062050A1 (en) | 2021-10-14 | 2023-04-20 | F. Hoffmann-La Roche Ag | New interleukin-7 immunoconjugates |
US11639397B2 (en) | 2011-08-23 | 2023-05-02 | Roche Glycart Ag | Bispecific antibodies specific for T-cell activating antigens and a tumor antigen and methods of use |
WO2023092004A1 (en) | 2021-11-17 | 2023-05-25 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
WO2023094282A1 (en) | 2021-11-25 | 2023-06-01 | F. Hoffmann-La Roche Ag | Quantification of low amounts of antibody sideproducts |
US11673968B2 (en) | 2014-06-26 | 2023-06-13 | Hoffmann-La Roche Inc. | Anti-BRDU antibodies and methods of use |
WO2023104938A1 (en) | 2021-12-10 | 2023-06-15 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and plap |
US11685781B2 (en) | 2018-02-15 | 2023-06-27 | Macrogenics, Inc. | Variant CD3-binding domains and their use in combination therapies for the treatment of disease |
US11718679B2 (en) | 2017-10-31 | 2023-08-08 | Compass Therapeutics Llc | CD137 antibodies and PD-1 antagonists and uses thereof |
WO2023150778A1 (en) | 2022-02-07 | 2023-08-10 | Visterra, Inc. | Anti-idiotype antibody molecules and uses thereof |
US11739144B2 (en) | 2021-03-09 | 2023-08-29 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CLDN6 |
US11752207B2 (en) | 2017-07-11 | 2023-09-12 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
WO2023174521A1 (en) | 2022-03-15 | 2023-09-21 | Genmab A/S | Binding agents binding to epcam and cd137 |
WO2023175064A1 (en) | 2022-03-17 | 2023-09-21 | Astrazeneca Ab | Methods for purifying bispecific antibodies |
WO2023180353A1 (en) | 2022-03-23 | 2023-09-28 | F. Hoffmann-La Roche Ag | Combination treatment of an anti-cd20/anti-cd3 bispecific antibody and chemotherapy |
US11773170B2 (en) | 2017-08-09 | 2023-10-03 | Merus N.V. | Antibodies that bind EGFR and cMET |
US11773166B2 (en) | 2014-11-04 | 2023-10-03 | Ichnos Sciences SA | CD3/CD38 T cell retargeting hetero-dimeric immunoglobulins and methods of their production |
US11780925B2 (en) | 2017-03-31 | 2023-10-10 | Merus N.V. | ErbB-2 and ErbB3 binding bispecific antibodies for use in the treatment of cells that have an NRG1 fusion gene |
WO2023198727A1 (en) | 2022-04-13 | 2023-10-19 | F. Hoffmann-La Roche Ag | Pharmaceutical compositions of anti-cd20/anti-cd3 bispecific antibodies and methods of use |
US11795226B2 (en) | 2017-12-12 | 2023-10-24 | Macrogenics, Inc. | Bispecific CD16-binding molecules and their use in the treatment of disease |
WO2023202967A1 (en) | 2022-04-19 | 2023-10-26 | F. Hoffmann-La Roche Ag | Improved production cells |
WO2023209568A1 (en) | 2022-04-26 | 2023-11-02 | Novartis Ag | Multispecific antibodies targeting il-13 and il-18 |
WO2023220695A2 (en) | 2022-05-13 | 2023-11-16 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
WO2023218051A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
WO2023232961A1 (en) | 2022-06-03 | 2023-12-07 | F. Hoffmann-La Roche Ag | Improved production cells |
US11845799B2 (en) | 2019-12-13 | 2023-12-19 | Genentech, Inc. | Anti-Ly6G6D antibodies and methods of use |
US11845805B2 (en) | 2020-09-10 | 2023-12-19 | Genmab A/S | Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma |
US11859012B2 (en) | 2021-03-10 | 2024-01-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and GPC3 |
US11858995B2 (en) | 2020-09-10 | 2024-01-02 | Genmab A/S | Bispecific antibodies against CD3 and CD20 for treating chronic lymphocytic leukemia |
US11866498B2 (en) | 2018-02-08 | 2024-01-09 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
WO2024030976A2 (en) | 2022-08-03 | 2024-02-08 | Voyager Therapeutics, Inc. | Compositions and methods for crossing the blood brain barrier |
EP4324518A2 (en) | 2014-01-31 | 2024-02-21 | Novartis AG | Antibody molecules to tim-3 and uses thereof |
US11919956B2 (en) | 2020-05-14 | 2024-03-05 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3 |
US11932675B2 (en) | 2019-10-11 | 2024-03-19 | Genentech, Inc. | PD-1 targeted IL-15/IL-15Rα Fc fusion proteins with improved properties |
WO2024059739A1 (en) | 2022-09-15 | 2024-03-21 | Voyager Therapeutics, Inc. | Tau binding compounds |
US11939394B2 (en) | 2015-10-23 | 2024-03-26 | Merus N.V. | Binding molecules that inhibit cancer growth |
WO2024079010A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and cd38 antibodies |
WO2024079015A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and imids |
WO2024079069A1 (en) | 2022-10-12 | 2024-04-18 | F. Hoffmann-La Roche Ag | Method for classifying cells |
WO2024079009A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and proteasome inhibitors |
WO2024094660A1 (en) | 2022-10-31 | 2024-05-10 | Genmab A/S | Cd38 antibodies and uses thereof |
US11981737B2 (en) | 2016-11-18 | 2024-05-14 | Hoffmann-La Roche Inc. | Anti-HLA-G antibodies and use thereof |
WO2024100170A1 (en) | 2022-11-11 | 2024-05-16 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a*02/foxp3 |
WO2024104988A1 (en) | 2022-11-15 | 2024-05-23 | F. Hoffmann-La Roche Ag | Recombinant binding proteins with activatable effector domain |
WO2024104933A1 (en) | 2022-11-15 | 2024-05-23 | F. Hoffmann-La Roche Ag | Antigen binding molecules |
WO2024107752A2 (en) | 2022-11-15 | 2024-05-23 | Onestone Therapeutics Llc | Compositions and methods for immunomodulatory bifunctional fusion molecules |
US11999801B2 (en) | 2014-12-03 | 2024-06-04 | Hoffman-La Roche Inc. | Multispecific antibodies |
Families Citing this family (134)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7091321B2 (en) | 2000-02-11 | 2006-08-15 | Emd Lexigen Research Center Corp. | Enhancing the circulating half-life of antibody-based fusion proteins |
HUP0303428A2 (en) | 2001-03-07 | 2004-01-28 | Merck Patent Gmbh. | Expression technology for proteins containing a hybrid isotype antibody moiety |
US6992174B2 (en) | 2001-03-30 | 2006-01-31 | Emd Lexigen Research Center Corp. | Reducing the immunogenicity of fusion proteins |
BR0209177A (en) | 2001-05-03 | 2004-10-05 | Merck Patent Gmbh | Recombinant tumor specific antibody and use |
CN100390282C (en) | 2001-12-04 | 2008-05-28 | 默克专利有限公司 | Immunocytokines with modulated selectivity |
ATE393169T1 (en) | 2003-12-30 | 2008-05-15 | Merck Patent Gmbh | IL-7 FUSION PROTEINS WITH ANTIBODIES, THEIR PRODUCTION AND THEIR USE |
US7670595B2 (en) | 2004-06-28 | 2010-03-02 | Merck Patent Gmbh | Fc-interferon-beta fusion proteins |
DK1999154T3 (en) | 2006-03-24 | 2012-12-03 | Merck Patent Gmbh | MANUFACTURED HETERODIMERED PROTEIN DOMAINS |
CN105177091A (en) | 2006-03-31 | 2015-12-23 | 中外制药株式会社 | Antibody modification method for purifying bispecific antibody |
HUE028379T2 (en) | 2006-09-29 | 2016-12-28 | Oncomed Pharm Inc | Compositions and methods for diagnosing and treating cancer |
KR20110003547A (en) * | 2008-04-25 | 2011-01-12 | 메르크 파텐트 게엠베하 | Artificial protein scaffolds |
JP5646457B2 (en) | 2008-04-29 | 2014-12-24 | アッヴィ・インコーポレイテッド | Dual variable domain immunoglobulins and uses thereof |
KR20110016958A (en) | 2008-06-03 | 2011-02-18 | 아보트 러보러터리즈 | Dual variable domain immunoglobulins and uses thereof |
BRPI1016204A2 (en) | 2009-04-22 | 2016-04-19 | Merck Patent Gmbh | antibody fusion proteins with modified fcrn binding sites |
US9493578B2 (en) | 2009-09-02 | 2016-11-15 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
US8883145B2 (en) | 2009-10-16 | 2014-11-11 | Oncomed Pharmaceuticals, Inc. | Methods of treatment with DLL4 antagonists and an anti-hypertensive agent |
UY33492A (en) | 2010-07-09 | 2012-01-31 | Abbott Lab | IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME |
CA2807014A1 (en) | 2010-08-03 | 2012-02-09 | Abbvie Inc. | Dual variable domain immunoglobulins and uses thereof |
US8551479B2 (en) | 2010-09-10 | 2013-10-08 | Oncomed Pharmaceuticals, Inc. | Methods for treating melanoma |
JP6400470B2 (en) | 2011-05-16 | 2018-10-03 | ジェネロン(シャンハイ)コーポレイション リミテッド | Multispecific Fab fusion proteins and methods of use |
GB201116092D0 (en) | 2011-09-16 | 2011-11-02 | Bioceros B V | Antibodies and uses thereof |
US9212227B2 (en) | 2012-04-30 | 2015-12-15 | Janssen Biotech, Inc. | ST2L antibody antagonists for the treatment of ST2L-mediated inflammatory pulmonary conditions |
US9890216B2 (en) | 2012-10-23 | 2018-02-13 | Board Of Regents, The University Of Texas System | Antibodies with engineered IgG Fc domains |
CA2889638A1 (en) | 2012-10-31 | 2014-05-08 | Oncomed Pharmaceuticals, Inc. | Methods and monitoring of treatment with a dll4 antagonist |
JP6571527B2 (en) * | 2012-11-21 | 2019-09-04 | ウーハン ワイゼットワイ バイオファルマ カンパニー リミテッドWuhan Yzy Biopharma Co., Ltd. | Bispecific antibody |
MX366124B (en) | 2013-03-15 | 2019-06-27 | Janssen Biotech Inc | Interferon alpha and omega antibody antagonists. |
MD4633B1 (en) | 2013-03-18 | 2019-06-30 | Biocerox Products B.V. | Humanized anti-CD134 (OX40) antibodies and uses thereof |
WO2015069865A1 (en) | 2013-11-06 | 2015-05-14 | Janssen Biotech, Inc. | Anti-ccl17 antibodies |
US9732154B2 (en) | 2014-02-28 | 2017-08-15 | Janssen Biotech, Inc. | Anti-CD38 antibodies for treatment of acute lymphoblastic leukemia |
ES2900898T3 (en) | 2014-04-07 | 2022-03-18 | Chugai Pharmaceutical Co Ltd | Bispecific immunoactivating antibodies |
WO2015174439A1 (en) | 2014-05-13 | 2015-11-19 | 中外製薬株式会社 | T cell-redirected antigen-binding molecule for cells having immunosuppression function |
TWI713453B (en) | 2014-06-23 | 2020-12-21 | 美商健生生物科技公司 | Interferon alpha and omega antibody antagonists |
BR112016030740A2 (en) | 2014-07-01 | 2018-02-20 | Pfizer Inc. | bispecific heterodimeric bodies and their uses |
EA035979B1 (en) | 2014-09-09 | 2020-09-08 | Янссен Байотек, Инк. | Combination therapies with anti-cd38 antibodies |
MA40764A (en) | 2014-09-26 | 2017-08-01 | Chugai Pharmaceutical Co Ltd | THERAPEUTIC AGENT INDUCING CYTOTOXICITY |
CN107530419B (en) | 2014-10-31 | 2021-05-18 | 昂考梅德药品有限公司 | Combination therapy for treating disease |
CA2976236A1 (en) | 2015-02-09 | 2016-08-18 | Research Development Foundation | Engineered immunoglobulin fc polypeptides displaying improved complement activation |
CA2986594A1 (en) | 2015-05-20 | 2016-11-24 | Tufts Medical Center, Inc. | Anti-cd38 antibodies for treatment of light chain amyloidosis and other cd38-positive hematological malignancies |
CN104833797B (en) * | 2015-06-04 | 2017-02-01 | 武汉友芝友生物制药有限公司 | ELISA method of detecting bispecific antibody MSBODY and application of the method |
CN107708734B (en) | 2015-06-22 | 2022-01-11 | 詹森生物科技公司 | Combination therapy of heme malignancies with anti-CD 38 antibodies and survivin inhibitors |
EP3313441B1 (en) | 2015-06-24 | 2024-02-21 | Janssen Biotech, Inc. | Immune modulation and treatment of solid tumors with antibodies that specifically bind cd38 |
ES2944982T3 (en) | 2015-08-05 | 2023-06-27 | Janssen Biotech Inc | Anti-CD154 antibodies and methods of using them |
CA2999160A1 (en) | 2015-09-23 | 2017-03-30 | Oncomed Pharmaceuticals, Inc. | Methods and compositions for treatment of cancer |
JP2018529351A (en) | 2015-09-30 | 2018-10-11 | ヤンセン バイオテツク,インコーポレーテツド | Antagonist antibodies that specifically bind to human CD40 and methods of use |
EA201891093A1 (en) | 2015-11-03 | 2018-10-31 | Янссен Байотек, Инк. | ANTIBODIES SPECIFICALLY BINDING PD-1 AND THEIR APPLICATION |
KR20180067693A (en) | 2015-11-03 | 2018-06-20 | 얀센 바이오테크 인코포레이티드 | Subcutaneous preparations of anti-CD38 antibodies and uses thereof |
JP6925278B2 (en) | 2015-11-18 | 2021-08-25 | 中外製薬株式会社 | Method of enhancing humoral immune response |
WO2017086367A1 (en) | 2015-11-18 | 2017-05-26 | 中外製薬株式会社 | Combination therapy using t cell redirection antigen binding molecule against cell having immunosuppressing function |
CN108713027A (en) | 2015-12-17 | 2018-10-26 | 詹森生物科技公司 | Specifically bind the antibody and application thereof of HLA-DR |
AU2016381992B2 (en) | 2015-12-28 | 2024-01-04 | Chugai Seiyaku Kabushiki Kaisha | Method for promoting efficiency of purification of Fc region-containing polypeptide |
MX2018010988A (en) | 2016-03-14 | 2019-01-21 | Chugai Pharmaceutical Co Ltd | Cell injury inducing therapeutic drug for use in cancer therapy. |
JP7034489B2 (en) | 2016-03-15 | 2022-03-14 | アイタブメッド (エイチケイ) リミテッド | Multispecific Fab fusion protein and its use |
CA3016563A1 (en) | 2016-03-21 | 2017-09-28 | Elstar Therapeutics, Inc. | Multispecific and multifunctional molecules and uses thereof |
EP3474895A1 (en) | 2016-06-28 | 2019-05-01 | UMC Utrecht Holding B.V. | TREATMENT OF IgE-MEDIATED DISEASES WITH ANTIBODIES THAT SPECIFICALLY BIND CD38 |
US10696722B2 (en) | 2016-08-10 | 2020-06-30 | Ajou University Industry-Academic Cooperation Foundation | Heterodimeric Fc-fused cytokine and pharmaceutical composition comprising the same |
KR102554331B1 (en) | 2016-08-12 | 2023-07-10 | 얀센 바이오테크 인코포레이티드 | Fc engineered anti-TNFR superfamily member antibodies with enhanced agonistic activity and methods of use thereof |
SG11201900746RA (en) | 2016-08-12 | 2019-02-27 | Janssen Biotech Inc | Engineered antibodies and other fc-domain containing molecules with enhanced agonism and effector functions |
WO2018095932A1 (en) | 2016-11-22 | 2018-05-31 | Merck Patent Gmbh | Monoclonal antibody directed to fgfr1 |
US20200291089A1 (en) | 2017-02-16 | 2020-09-17 | Elstar Therapeutics, Inc. | Multifunctional molecules comprising a trimeric ligand and uses thereof |
JP7165717B2 (en) | 2017-03-15 | 2022-11-04 | パンディオン・オペレーションズ・インコーポレイテッド | target immune tolerance |
WO2018217989A1 (en) | 2017-05-24 | 2018-11-29 | Pandion Therapeutics, Inc. | Targeted immunotolerance |
JP2020522254A (en) | 2017-05-31 | 2020-07-30 | エルスター セラピューティクス, インコーポレイテッド | Multispecific molecules that bind myeloproliferative leukemia (MPL) proteins and uses thereof |
WO2019035938A1 (en) | 2017-08-16 | 2019-02-21 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to bcma and uses thereof |
US10947295B2 (en) | 2017-08-22 | 2021-03-16 | Sanabio, Llc | Heterodimers of soluble interferon receptors and uses thereof |
CN111032674B (en) | 2017-08-30 | 2024-02-27 | 阿雷斯贸易股份有限公司 | Protein purification method |
SG11202002581WA (en) | 2017-09-21 | 2020-04-29 | Umc Utrecht Holding Bv | Anti-gd2 antibody for the treatment of neuroblastoma |
EP3684791A1 (en) | 2017-09-21 | 2020-07-29 | Merck Patent GmbH | Fusion protein comprising an fgf-18 moiety |
WO2019100052A2 (en) | 2017-11-20 | 2019-05-23 | Compass Therapeutics Llc | Cd137 antibodies and tumor antigen-targeting antibodies and uses thereof |
US10946068B2 (en) | 2017-12-06 | 2021-03-16 | Pandion Operations, Inc. | IL-2 muteins and uses thereof |
US10174091B1 (en) | 2017-12-06 | 2019-01-08 | Pandion Therapeutics, Inc. | IL-2 muteins |
MX2020007444A (en) | 2018-01-12 | 2020-09-14 | Genzyme Corp | Methods for the quantitation of polypeptides. |
US20210238280A1 (en) | 2018-03-14 | 2021-08-05 | Elstar Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
US20210009711A1 (en) | 2018-03-14 | 2021-01-14 | Elstar Therapeutics, Inc. | Multifunctional molecules and uses thereof |
EP3793599A1 (en) | 2018-05-16 | 2021-03-24 | Janssen Biotech, Inc. | Bcma/cd3 and gprdc5d/cd3 bispecific antibodies for use in cancer therapy |
US20210221910A1 (en) | 2018-05-18 | 2021-07-22 | Glycotope Gmbh | Anti-muc1 antibody |
WO2019224713A2 (en) | 2018-05-24 | 2019-11-28 | Janssen Biotech, Inc. | Monospecific and multispecific anti-tmeff2 antibodies and there uses |
AU2019274657A1 (en) | 2018-05-24 | 2020-12-10 | Janssen Biotech, Inc. | PSMA binding agents and uses thereof |
EP3802608A2 (en) | 2018-05-24 | 2021-04-14 | Janssen Biotech, Inc. | Anti-cd3 antibodies and uses thereof |
CN112955465A (en) | 2018-07-03 | 2021-06-11 | 马伦戈治疗公司 | anti-TCR antibody molecules and uses thereof |
CA3110039A1 (en) | 2018-08-29 | 2020-03-05 | Merck Biodevelopment S.A.S. | New purification method |
PE20211279A1 (en) | 2018-10-23 | 2021-07-19 | Dragonfly Therapeutics Inc | HETERODIMERIC PROTEINS FUSED WITH FC |
AU2019371462A1 (en) | 2018-11-02 | 2021-05-20 | University Of Washington | Orthogonal protein heterodimers |
CA3124770A1 (en) | 2018-12-24 | 2020-07-02 | Sanofi | Pseudofab-based multispecific binding proteins |
EP3902823A1 (en) | 2018-12-24 | 2021-11-03 | Sanofi | Multispecific binding proteins with mutant fab domains |
TW202043256A (en) | 2019-01-10 | 2020-12-01 | 美商健生生物科技公司 | Prostate neoantigens and their uses |
BR112021013824A2 (en) | 2019-01-18 | 2021-12-14 | Janssen Biotech Inc | gprc5d chimeric antigen receptors and cells expressing the same |
AU2020224680A1 (en) | 2019-02-21 | 2021-09-16 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to T cells and uses thereof to treat autoimmune disorders |
JP2022523197A (en) | 2019-02-21 | 2022-04-21 | マレンゴ・セラピューティクス,インコーポレーテッド | Multifunctional molecules that bind to T cell-related cancer cells and their use |
AU2020224681A1 (en) | 2019-02-21 | 2021-09-16 | Marengo Therapeutics, Inc. | Antibody molecules that bind to NKp30 and uses thereof |
JP2022521751A (en) | 2019-02-21 | 2022-04-12 | マレンゴ・セラピューティクス,インコーポレーテッド | Anti-TCR antibody molecule and its use |
EP3927746A1 (en) | 2019-02-21 | 2021-12-29 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
MX2021010265A (en) | 2019-02-26 | 2021-09-23 | Janssen Biotech Inc | Combination therapies and patient stratification with bispecific anti-egfr/c-met antibodies. |
WO2020197400A1 (en) | 2019-03-27 | 2020-10-01 | Umc Utrecht Holding B.V. | Engineered iga antibodies and methods of use |
WO2020212947A1 (en) | 2019-04-19 | 2020-10-22 | Janssen Biotech, Inc. | Methods of treating prostate cancer with an anti- psma/cd3 antibody |
CA3139508A1 (en) | 2019-05-08 | 2020-11-12 | Janssen Biotech, Inc. | Materials and methods for modulating t cell mediated immunity |
WO2020230091A1 (en) | 2019-05-14 | 2020-11-19 | Janssen Biotech, Inc. | Combination therapies with bispecific anti-egfr/c-met antibodies and third generation egfr tyrosine kinase inhibitors |
KR20220035333A (en) | 2019-05-20 | 2022-03-22 | 팬디온 오퍼레이션스, 인코포레이티드 | MADCAM Targeted Immune Tolerance |
CA3136992A1 (en) * | 2019-05-24 | 2020-12-03 | Proviva Therapeutics (Hong Kong) Limited | Il-2 compositions and methods of use thereof |
KR20220040483A (en) | 2019-07-26 | 2022-03-30 | 얀센 바이오테크 인코포레이티드 | Proteins comprising kallikrein-associated peptidase 2 antigen binding domains and uses thereof |
WO2021030657A1 (en) | 2019-08-15 | 2021-02-18 | Janssen Biotech, Inc. | Materials and methods for improved single chain variable fragments |
EP4061837A1 (en) | 2019-11-18 | 2022-09-28 | Janssen Biotech, Inc. | Anti-cd79 chimeric antigen receptors, car-t cells, and uses thereof |
WO2021138407A2 (en) | 2020-01-03 | 2021-07-08 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to cd33 and uses thereof |
KR20220144377A (en) | 2020-01-30 | 2022-10-26 | 우모자 바이오파마 인코포레이티드 | Bispecific transduction promoter |
TW202144388A (en) | 2020-02-14 | 2021-12-01 | 美商健生生物科技公司 | Neoantigens expressed in ovarian cancer and their uses |
TW202144389A (en) | 2020-02-14 | 2021-12-01 | 美商健生生物科技公司 | Neoantigens expressed in multiple myeloma and their uses |
WO2021168079A1 (en) | 2020-02-21 | 2021-08-26 | Pandion Operations, Inc. | Tissue targeted immunotolerance with a cd39 effector |
EP4233895A3 (en) | 2020-03-13 | 2023-09-27 | Janssen Biotech, Inc. | Materials and methods for binding siglec-3/cd33 |
EP4139363A1 (en) | 2020-04-24 | 2023-03-01 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to t cell related cancer cells and uses thereof |
MX2022014938A (en) | 2020-05-27 | 2023-03-06 | Janssen Biotech Inc | Proteins comprising cd3 antigen binding domains and uses thereof. |
EP4161581A1 (en) | 2020-06-03 | 2023-04-12 | Merck Patent GmbH | Bispecific antibody-drug conjugates targeting egfr and muc1 and uses thereof |
EP4188439A2 (en) | 2020-07-29 | 2023-06-07 | Janssen Biotech, Inc. | Proteins comprising hla-g antigen binding domains and their uses |
EP4204096A2 (en) | 2020-08-26 | 2023-07-05 | Marengo Therapeutics, Inc. | Antibody molecules that bind to nkp30 and uses thereof |
JP2023540248A (en) | 2020-08-26 | 2023-09-22 | マレンゴ・セラピューティクス,インコーポレーテッド | How to detect TRBC1 or TRBC2 |
CA3190755A1 (en) | 2020-08-26 | 2022-03-03 | Andreas Loew | Multifunctional molecules that bind to calreticulin and uses thereof |
JP2023544254A (en) | 2020-09-14 | 2023-10-23 | ストロ バイオファーマ, インコーポレイテッド | Large-scale antibody production method using cell-free protein synthesis system |
CA3198590A1 (en) | 2020-10-13 | 2022-04-21 | Rajkumar Ganesan | Bioengineered t cell mediated immunity, materials and other methods for modulating cluster of differentiation iv &/or viii |
CA3199319A1 (en) | 2020-10-22 | 2022-04-28 | Janssen Biotech, Inc. | Proteins comprising delta-like ligand 3 (dll3) antigen binding domains and their uses |
WO2022128716A1 (en) | 2020-12-17 | 2022-06-23 | Merck Patent Gmbh | Pharmaceutical composition comprising a bispecific anti-muc1/egfr antibody-drug conjugate |
EP4284838A2 (en) | 2021-01-28 | 2023-12-06 | Janssen Biotech, Inc. | Psma binding proteins and uses thereof |
CA3211114A1 (en) | 2021-02-16 | 2022-08-25 | Janssen Biotech, Inc. | Materials and methods for enhanced linker targeting |
BR112023018278A2 (en) | 2021-03-09 | 2023-10-31 | Janssen Biotech Inc | TREATMENT OF CANCERS WITHOUT EGFR ACTIVATING MUTATIONS |
IL306103A (en) | 2021-03-24 | 2023-11-01 | Janssen Biotech Inc | Antibody targeting cd22 and cd79b |
JP2024510777A (en) | 2021-03-24 | 2024-03-11 | ヤンセン バイオテツク,インコーポレーテツド | Proteins containing CD3 antigen binding domain and uses thereof |
AU2022255506A1 (en) | 2021-04-08 | 2023-11-09 | Marengo Therapeutics, Inc. | Multifunctional molecules binding to tcr and uses thereof |
TW202309094A (en) | 2021-05-18 | 2023-03-01 | 美商健生生物科技公司 | Methods for identifying cancer patients for combination treatment |
KR20240055002A (en) | 2021-09-13 | 2024-04-26 | 얀센 바이오테크 인코포레이티드 | CD33 x Vδ2 multispecific antibody for cancer treatment |
WO2023046322A1 (en) | 2021-09-24 | 2023-03-30 | Janssen Pharmaceutica Nv | Proteins comprising cd20 binding domains, and uses thereof |
WO2023089587A1 (en) | 2021-11-22 | 2023-05-25 | Janssen Biotech, Inc. | Compositions comprising enhanced multispecific binding agents for an immune response |
US20230183360A1 (en) | 2021-12-09 | 2023-06-15 | Janssen Biotech, Inc. | Use of Amivantamab to Treat Colorectal Cancer |
TW202342057A (en) | 2022-02-07 | 2023-11-01 | 美商健生生物科技公司 | Methods for reducing infusion-related reactions in patients treated with egfr/met bispecific antibodies |
WO2023192850A1 (en) | 2022-03-29 | 2023-10-05 | Ngm Biopharmaceuticals, Inc. | Ilt3 and cd3 binding agents and methods of use thereof |
WO2024003837A1 (en) | 2022-06-30 | 2024-01-04 | Janssen Biotech, Inc. | Use of anti-egfr/anti-met antibody to treat gastric or esophageal cancer |
WO2024089551A1 (en) | 2022-10-25 | 2024-05-02 | Janssen Biotech, Inc. | Msln and cd3 binding agents and methods of use thereof |
WO2024095173A1 (en) | 2022-11-02 | 2024-05-10 | Janssen Biotech, Inc. | Methods of treating cancers |
Family Cites Families (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
AU5670194A (en) | 1992-11-20 | 1994-06-22 | Enzon, Inc. | Linker for linked fusion polypeptides |
US5731168A (en) * | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
US20020062010A1 (en) | 1997-05-02 | 2002-05-23 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
US6472179B2 (en) | 1998-09-25 | 2002-10-29 | Regeneron Pharmaceuticals, Inc. | Receptor based antagonists and methods of making and using |
WO2001000814A2 (en) * | 1999-06-25 | 2001-01-04 | Universität Zürich | Hetero-associating coiled-coil peptides and screenign method therefor |
BR0209177A (en) | 2001-05-03 | 2004-10-05 | Merck Patent Gmbh | Recombinant tumor specific antibody and use |
US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
US20050249723A1 (en) * | 2003-12-22 | 2005-11-10 | Xencor, Inc. | Fc polypeptides with novel Fc ligand binding sites |
AU2005282700A1 (en) * | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
ES2592271T3 (en) * | 2005-03-31 | 2016-11-29 | Chugai Seiyaku Kabushiki Kaisha | Polypeptide production methods by regulating the association of polypeptides |
DK1999154T3 (en) | 2006-03-24 | 2012-12-03 | Merck Patent Gmbh | MANUFACTURED HETERODIMERED PROTEIN DOMAINS |
-
2007
- 2007-03-23 DK DK07723539T patent/DK1999154T3/en active
- 2007-03-23 ES ES07723539T patent/ES2395969T3/en active Active
- 2007-03-23 CA CA2646965A patent/CA2646965C/en active Active
- 2007-03-23 JP JP2009501919A patent/JP5474531B2/en active Active
- 2007-03-23 WO PCT/EP2007/002590 patent/WO2007110205A2/en active Application Filing
- 2007-03-23 PL PL07723539T patent/PL1999154T3/en unknown
- 2007-03-23 EP EP20070723539 patent/EP1999154B1/en active Active
- 2007-03-23 SI SI200731095T patent/SI1999154T1/en unknown
- 2007-03-23 AU AU2007229698A patent/AU2007229698B9/en active Active
- 2007-03-23 AR ARP070101189 patent/AR060070A1/en unknown
- 2007-03-23 PT PT07723539T patent/PT1999154E/en unknown
- 2007-03-23 US US11/728,048 patent/US8871912B2/en active Active
-
2008
- 2008-09-16 IL IL194145A patent/IL194145A/en active IP Right Grant
-
2013
- 2013-10-01 JP JP2013206531A patent/JP6104121B2/en active Active
-
2014
- 2014-10-03 US US14/505,653 patent/US9505848B2/en active Active
-
2016
- 2016-11-28 US US15/362,319 patent/US20170145078A1/en not_active Abandoned
- 2016-12-01 JP JP2016234369A patent/JP2017046720A/en active Pending
-
2018
- 2018-12-12 US US16/217,613 patent/US20190211079A1/en not_active Abandoned
Non-Patent Citations (1)
Title |
---|
None |
Cited By (588)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10934571B2 (en) | 2002-07-18 | 2021-03-02 | Merus N.V. | Recombinant production of mixtures of antibodies |
USRE47770E1 (en) | 2002-07-18 | 2019-12-17 | Merus N.V. | Recombinant production of mixtures of antibodies |
US11168344B2 (en) | 2005-03-31 | 2021-11-09 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
US10011858B2 (en) | 2005-03-31 | 2018-07-03 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
US10906991B2 (en) | 2007-03-29 | 2021-02-02 | Genmab A/S | Bispecific antibodies and methods for production thereof |
US9212230B2 (en) | 2007-03-29 | 2015-12-15 | Genmab A/S | Bispecific antibodies and methods for production thereof |
US10138293B2 (en) | 2007-12-21 | 2018-11-27 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
US10927163B2 (en) | 2007-12-21 | 2021-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
WO2009089004A1 (en) * | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
AU2015202560B2 (en) * | 2008-01-07 | 2017-06-15 | Amgen Inc. | Method for Making Antibody Fc-Heterodimeric Molecules Using Electrostatic Steering Effects |
EP3663318A1 (en) * | 2008-01-07 | 2020-06-10 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
US8592562B2 (en) | 2008-01-07 | 2013-11-26 | Amgen Inc. | Method for making antibody Fc-heterodimeric molecules using electrostatic steering effects |
AU2009204501B2 (en) * | 2008-01-07 | 2015-02-12 | Amgen Inc. | Method for making antibody Fc-heterodimeric molecules using electrostatic steering effects |
EP3061770A1 (en) * | 2008-01-07 | 2016-08-31 | Amgen, Inc | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
WO2010112193A1 (en) * | 2009-04-02 | 2010-10-07 | Roche Glycart Ag | Multispecific antibodies comprising full length antibodies and single chain fab fragments |
US9890204B2 (en) | 2009-04-07 | 2018-02-13 | Hoffmann-La Roche Inc. | Trivalent, bispecific antibodies |
US11993642B2 (en) | 2009-04-07 | 2024-05-28 | Hoffmann-La Roche Inc. | Trivalent, bispecific antibodies |
EP2424567A4 (en) * | 2009-04-27 | 2013-07-17 | Oncomed Pharm Inc | Method for making heteromultimeric molecules |
EP2424567A2 (en) * | 2009-04-27 | 2012-03-07 | OncoMed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
US9914771B2 (en) | 2009-04-27 | 2018-03-13 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
US9309311B2 (en) | 2009-04-27 | 2016-04-12 | Oncomed Pharmaceuticals, Inc. | Method for making Heteromultimeric molecules |
EP3505636A1 (en) * | 2009-04-27 | 2019-07-03 | OncoMed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
US9067986B2 (en) | 2009-04-27 | 2015-06-30 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
US10640555B2 (en) | 2009-06-16 | 2020-05-05 | Hoffmann-La Roche Inc. | Bispecific antigen binding proteins |
US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
US11673945B2 (en) | 2009-06-16 | 2023-06-13 | Hoffmann-La Roche Inc. | Bispecific antigen binding proteins |
US9308258B2 (en) | 2009-07-08 | 2016-04-12 | Amgen Inc. | Stable and aggregation free antibody FC molecules through CH3 domain interface engineering |
US9994646B2 (en) | 2009-09-16 | 2018-06-12 | Genentech, Inc. | Coiled coil and/or tether containing protein complexes and uses thereof |
US10106600B2 (en) | 2010-03-26 | 2018-10-23 | Roche Glycart Ag | Bispecific antibodies |
US10597464B2 (en) | 2010-04-20 | 2020-03-24 | Genmab A/S | Heterodimeric antibody Fc-containing proteins and methods for production thereof |
US9150663B2 (en) | 2010-04-20 | 2015-10-06 | Genmab A/S | Heterodimeric antibody Fc-containing proteins and methods for production thereof |
WO2011131746A3 (en) * | 2010-04-20 | 2011-12-29 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
US11866514B2 (en) | 2010-04-20 | 2024-01-09 | Genmab A/S | Heterodimeric antibody Fc-containing proteins and methods for production thereof |
WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
US9605061B2 (en) | 2010-07-29 | 2017-03-28 | Xencor, Inc. | Antibodies with modified isoelectric points |
US9879095B2 (en) | 2010-08-24 | 2018-01-30 | Hoffman-La Roche Inc. | Bispecific antibodies comprising a disulfide stabilized-Fv fragment |
EP2635607A4 (en) * | 2010-11-05 | 2014-05-28 | Zymeworks Inc | Stable heterodimeric antibody design with mutations in the fc domain |
KR20190015583A (en) * | 2010-11-05 | 2019-02-13 | 자임워크스 인코포레이티드 | Stable heterodimeric antibody design with mutations in the fc domain |
EP2635607A1 (en) * | 2010-11-05 | 2013-09-11 | Zymeworks, Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
US9562109B2 (en) | 2010-11-05 | 2017-02-07 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the Fc domain |
KR101973930B1 (en) | 2010-11-05 | 2019-04-29 | 자임워크스 인코포레이티드 | Stable heterodimeric antibody design with mutations in the fc domain |
CN103429620B (en) * | 2010-11-05 | 2018-03-06 | 酵活有限公司 | There is the antibody design of the stable heterodimeric of mutation in Fc domains |
CN103429620A (en) * | 2010-11-05 | 2013-12-04 | 酵活有限公司 | Stable heterodimeric antibody design with mutations in the Fc domain |
US10875931B2 (en) | 2010-11-05 | 2020-12-29 | Zymeworks, Inc. | Stable heterodimeric antibody design with mutations in the Fc domain |
EP2638073A2 (en) * | 2010-11-09 | 2013-09-18 | Altimab Therapeutics, Inc. | Protein complexes for antigen binding and methods of use |
EP2638073A4 (en) * | 2010-11-09 | 2014-05-07 | Altimab Therapeutics Inc | Protein complexes for antigen binding and methods of use |
CN103328514B (en) * | 2010-11-09 | 2015-12-02 | 阿尔蒂单抗治疗公司 | The albumen composition combined for antigen and using method thereof |
US9518132B2 (en) | 2010-11-09 | 2016-12-13 | Altimab Therapeutics, Inc. | Protein complexes for antigen binding and methods of use |
CN103328514A (en) * | 2010-11-09 | 2013-09-25 | 阿尔蒂单抗治疗公司 | Protein complexes for antigen binding and methods of use |
US11066483B2 (en) | 2010-11-30 | 2021-07-20 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
US11618790B2 (en) | 2010-12-23 | 2023-04-04 | Hoffmann-La Roche Inc. | Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery |
US10793621B2 (en) | 2011-02-28 | 2020-10-06 | Hoffmann-La Roche Inc. | Nucleic acid encoding dual Fc antigen binding proteins |
US9982036B2 (en) | 2011-02-28 | 2018-05-29 | Hoffmann-La Roche Inc. | Dual FC antigen binding proteins |
US10611825B2 (en) | 2011-02-28 | 2020-04-07 | Hoffmann La-Roche Inc. | Monovalent antigen binding proteins |
AU2015210378B2 (en) * | 2011-03-25 | 2017-08-17 | Ichnos Sciences SA | Hetero-dimeric immunoglobulins |
CN103608357A (en) * | 2011-03-25 | 2014-02-26 | 格兰马克药品股份有限公司 | Hetero-dimeric immunoglobulins |
IL270815A (en) * | 2011-03-25 | 2020-01-30 | Glenmark Sciences Sa | Hetero-dimeric immunoglobulins |
CN108285488A (en) * | 2011-03-25 | 2018-07-17 | 格兰马克药品股份有限公司 | Heterodimer immunoglobulin |
WO2012131555A2 (en) | 2011-03-25 | 2012-10-04 | Glenmark Pharmaceuticals S.A. | Hetero-dimeric immunoglobulins |
AU2012235758B2 (en) * | 2011-03-25 | 2015-05-07 | Ichnos Sciences SA | Hetero-dimeric immunoglobulins |
CN107840894A (en) * | 2011-03-25 | 2018-03-27 | 格兰马克药品股份有限公司 | Heterodimer immunoglobulin |
CN108285488B (en) * | 2011-03-25 | 2023-01-24 | 伊克诺斯科学公司 | Heterodimeric immunoglobulins |
US9683053B2 (en) | 2011-03-25 | 2017-06-20 | Glenmark Pharmaceuticals S.A. | Hetero-dimeric immunoglobulins |
US9683052B2 (en) | 2011-03-25 | 2017-06-20 | Glenmark Pharmaceuticals S.A. | Hetero-dimeric immunoglobulins |
WO2012131555A3 (en) * | 2011-03-25 | 2012-12-27 | Glenmark Pharmaceuticals S.A. | Hetero-dimeric immunoglobulins |
IL270815B2 (en) * | 2011-03-25 | 2023-05-01 | Ichnos Sciences S A | Hetero-dimeric immunoglobulins |
EA028804B1 (en) * | 2011-03-25 | 2018-01-31 | Гленмарк Фармасьютикалс С.А. | Hetero-dimeric immunoglobulins |
KR102108521B1 (en) * | 2011-03-25 | 2020-05-11 | 아이크노스 사이언스 에스. 아. | Hetero-dimeric Immunoglobulins |
KR20130140112A (en) * | 2011-03-25 | 2013-12-23 | 그렌마크 파머수티칼스 에스. 아. | Hetero-dimeric immunoglobulins |
US9469676B2 (en) | 2011-04-13 | 2016-10-18 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
EP3896083A1 (en) | 2011-04-13 | 2021-10-20 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
US10214579B2 (en) | 2011-04-13 | 2019-02-26 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
WO2012142515A2 (en) | 2011-04-13 | 2012-10-18 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
EP3415528A2 (en) | 2011-04-13 | 2018-12-19 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
EP3144320A1 (en) | 2011-04-13 | 2017-03-22 | Bristol-Myers Squibb Company | Fc fusion proteins comprising novel linkers or arrangements |
WO2012143524A2 (en) | 2011-04-20 | 2012-10-26 | Genmab A/S | Bispecific antibodies against her2 and cd3 |
WO2013004842A2 (en) | 2011-07-06 | 2013-01-10 | Genmab A/S | Antibody variants and uses thereof |
EP3970746A2 (en) | 2011-07-06 | 2022-03-23 | Genmab B.V. | Polypeptide variants and uses thereof |
US11639397B2 (en) | 2011-08-23 | 2023-05-02 | Roche Glycart Ag | Bispecific antibodies specific for T-cell activating antigens and a tumor antigen and methods of use |
US11512128B2 (en) | 2011-09-23 | 2022-11-29 | Mereo Biopharma 5, Inc. | VEGF/DLL4 binding agents and uses thereof |
US10730940B2 (en) | 2011-09-23 | 2020-08-04 | Oncomed Pharmaceuticals, Inc. | VEGF/DLL4 binding agents and uses thereof |
US9879084B2 (en) | 2011-09-23 | 2018-01-30 | Oncomed Pharmaceuticals, Inc. | Modified immunoglobulin molecules that specifically bind human VEGF and DLL4 |
US10851178B2 (en) | 2011-10-10 | 2020-12-01 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
WO2013060867A2 (en) | 2011-10-27 | 2013-05-02 | Genmab A/S | Production of heterodimeric proteins |
US10344050B2 (en) | 2011-10-27 | 2019-07-09 | Genmab A/S | Production of heterodimeric proteins |
US11492371B2 (en) | 2011-10-27 | 2022-11-08 | Genmab A/S | Production of heterodimeric proteins |
EP2787078B1 (en) * | 2011-10-31 | 2019-05-22 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecule having regulated conjugation between heavy-chain and light-chain |
US9988460B2 (en) | 2011-11-04 | 2018-06-05 | Zymeworks Inc. | Crystal structures of heterodimeric Fc domains |
US9732155B2 (en) | 2011-11-04 | 2017-08-15 | Zymeworks Inc. | Crystal structures of heterodimeric Fc domains |
US9574010B2 (en) | 2011-11-04 | 2017-02-21 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the Fc domain |
US10457742B2 (en) | 2011-11-04 | 2019-10-29 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the Fc domain |
WO2013070565A1 (en) | 2011-11-07 | 2013-05-16 | Medimmune, Llc | Multispecific and multivalent binding proteins and uses thereof |
WO2013096291A2 (en) | 2011-12-20 | 2013-06-27 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
US9688758B2 (en) | 2012-02-10 | 2017-06-27 | Genentech, Inc. | Single-chain antibodies and other heteromultimers |
EP3594233A1 (en) | 2012-04-20 | 2020-01-15 | Merus N.V. | Methods and means for the production of ig-like molecules |
US10329596B2 (en) | 2012-04-20 | 2019-06-25 | Merus N.V. | Methods and means for the production of Ig-like molecules |
US9248181B2 (en) | 2012-04-20 | 2016-02-02 | Merus B.V. | Methods and means for the production of Ig-like molecules |
US10337045B2 (en) | 2012-04-20 | 2019-07-02 | Merus N.V. | Methods and means for the production of Ig-like molecules |
US9248182B2 (en) | 2012-04-20 | 2016-02-02 | Merus B.V. | Methods and means for the production of Ig-like molecules |
EP3594232A1 (en) | 2012-04-20 | 2020-01-15 | Merus N.V. | Methods and means for the production of ig-like molecules |
US11926859B2 (en) | 2012-04-20 | 2024-03-12 | Merus N.V. | Methods and means for the production of Ig-like molecules |
WO2013157953A1 (en) | 2012-04-20 | 2013-10-24 | Merus B.V. | Methods and means for the production of ig-like molecules |
US9758805B2 (en) | 2012-04-20 | 2017-09-12 | Merus N.V. | Methods and means for the production of Ig-like molecules |
US10752929B2 (en) | 2012-04-20 | 2020-08-25 | Merus N.V. | Methods and means for the production of ig-like molecules |
WO2013157954A1 (en) | 2012-04-20 | 2013-10-24 | Merus B.V. | Methods and means for the production of ig-like molecules |
US9358286B2 (en) | 2012-04-20 | 2016-06-07 | Merus B.V. | Methods and means for the production of IG-like molecules |
US9499634B2 (en) | 2012-06-25 | 2016-11-22 | Zymeworks Inc. | Process and methods for efficient manufacturing of highly pure asymmetric antibodies in mammalian cells |
US10508154B2 (en) | 2012-06-25 | 2019-12-17 | Zymeworks Inc. | Process and methods for efficient manufacturing of highly pure asymmetric antibodies in mammalian cells |
US10106612B2 (en) | 2012-06-27 | 2018-10-23 | Hoffmann-La Roche Inc. | Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof |
US11407836B2 (en) | 2012-06-27 | 2022-08-09 | Hoffmann-La Roche Inc. | Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof |
US11421022B2 (en) | 2012-06-27 | 2022-08-23 | Hoffmann-La Roche Inc. | Method for making antibody Fc-region conjugates comprising at least one binding entity that specifically binds to a target and uses thereof |
EP3632462A1 (en) | 2012-07-06 | 2020-04-08 | Genmab B.V. | Dimeric protein with triple mutations |
WO2014006217A1 (en) | 2012-07-06 | 2014-01-09 | Genmab B.V. | Dimeric protein with triple mutations |
EP3401337A1 (en) | 2012-09-25 | 2018-11-14 | Glenmark Pharmaceuticals S.A. | Purification of hetero-dimeric immunoglobulins |
WO2014049003A1 (en) | 2012-09-25 | 2014-04-03 | Glenmark Pharmaceuticals S.A. | Purification of hetero-dimeric immunoglobulins |
US9771573B2 (en) | 2012-10-03 | 2017-09-26 | Zymeworks Inc. | Methods of quantitating heavy and light chain polypeptide pairs |
US10494437B2 (en) | 2012-10-05 | 2019-12-03 | Kyowa Kirin Co., Ltd | Heterodimer protein composition |
WO2014054804A1 (en) | 2012-10-05 | 2014-04-10 | 協和発酵キリン株式会社 | Heterodimeric protein composition |
US9714291B2 (en) | 2012-10-05 | 2017-07-25 | Kyowa Hakko Kirin Co., Ltd | Heterodimer protein composition |
US10087250B2 (en) | 2012-10-08 | 2018-10-02 | Roche Glycart Ag | Fc-free antibodies comprising two fab-fragments and methods of use |
US11078296B2 (en) | 2012-11-28 | 2021-08-03 | Zymeworks Inc. | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
US9914785B2 (en) | 2012-11-28 | 2018-03-13 | Zymeworks Inc. | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
US10077298B2 (en) | 2012-11-28 | 2018-09-18 | Zymeworks Inc. | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
US11286293B2 (en) | 2012-11-28 | 2022-03-29 | Zymeworks, Inc. | Engineered immunoglobulin heavy chain-light chain pairs and uses thereof |
EP3738979A1 (en) | 2013-01-10 | 2020-11-18 | Genmab A/S | Inert format |
WO2014108483A1 (en) | 2013-01-10 | 2014-07-17 | Genmab B.V. | Inert format |
WO2014108198A1 (en) | 2013-01-10 | 2014-07-17 | Genmab B.V. | Human igg1 fc region variants and uses thereof |
US10487155B2 (en) | 2013-01-14 | 2019-11-26 | Xencor, Inc. | Heterodimeric proteins |
US10472427B2 (en) | 2013-01-14 | 2019-11-12 | Xencor, Inc. | Heterodimeric proteins |
US11634506B2 (en) | 2013-01-14 | 2023-04-25 | Xencor, Inc. | Heterodimeric proteins |
US10131710B2 (en) | 2013-01-14 | 2018-11-20 | Xencor, Inc. | Optimized antibody variable regions |
US11718667B2 (en) | 2013-01-14 | 2023-08-08 | Xencor, Inc. | Optimized antibody variable regions |
US10738133B2 (en) | 2013-01-14 | 2020-08-11 | Xencor, Inc. | Heterodimeric proteins |
US10738132B2 (en) | 2013-01-14 | 2020-08-11 | Xencor, Inc. | Heterodimeric proteins |
US9701759B2 (en) | 2013-01-14 | 2017-07-11 | Xencor, Inc. | Heterodimeric proteins |
US9650446B2 (en) | 2013-01-14 | 2017-05-16 | Xencor, Inc. | Heterodimeric proteins |
US11053316B2 (en) | 2013-01-14 | 2021-07-06 | Xencor, Inc. | Optimized antibody variable regions |
US9738722B2 (en) | 2013-01-15 | 2017-08-22 | Xencor, Inc. | Rapid clearance of antigen complexes using novel antibodies |
WO2014126884A1 (en) | 2013-02-12 | 2014-08-21 | Bristol-Myers Squibb Company | High ph protein refolding methods |
EP3299378A1 (en) | 2013-02-12 | 2018-03-28 | Bristol-Myers Squibb Company | High ph protein refolding methods |
EP3617220A1 (en) | 2013-02-12 | 2020-03-04 | Bristol-Myers Squibb Company | High ph protein refolding methods |
EP3744728A1 (en) | 2013-02-12 | 2020-12-02 | Bristol-Myers Squibb Company | Tangential flow filtration based protein refolding methods |
WO2014126871A1 (en) | 2013-02-12 | 2014-08-21 | Bristol-Myers Squibb Company | Tangential flow filtration based protein refolding methods |
US11459404B2 (en) | 2013-02-26 | 2022-10-04 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
US10155815B2 (en) | 2013-02-26 | 2018-12-18 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
US10781258B2 (en) | 2013-02-26 | 2020-09-22 | Roche Glycart Ag | Bispecific T cell activating antigen binding molecules |
US10781257B2 (en) | 2013-02-26 | 2020-09-22 | Roche GlyeArt AG | Bispecific T cell activating antigen binding molecules |
US10968276B2 (en) | 2013-03-12 | 2021-04-06 | Xencor, Inc. | Optimized anti-CD3 variable regions |
US11814423B2 (en) | 2013-03-15 | 2023-11-14 | Xencor, Inc. | Heterodimeric proteins |
US10858417B2 (en) | 2013-03-15 | 2020-12-08 | Xencor, Inc. | Heterodimeric proteins |
US9605084B2 (en) | 2013-03-15 | 2017-03-28 | Xencor, Inc. | Heterodimeric proteins |
US11299554B2 (en) | 2013-03-15 | 2022-04-12 | Xencor, Inc. | Heterodimeric proteins |
US10544187B2 (en) | 2013-03-15 | 2020-01-28 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
US10106624B2 (en) | 2013-03-15 | 2018-10-23 | Xencor, Inc. | Heterodimeric proteins |
US10519242B2 (en) | 2013-03-15 | 2019-12-31 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
US10287364B2 (en) | 2013-03-15 | 2019-05-14 | Xencor, Inc. | Heterodimeric proteins |
WO2014177460A1 (en) | 2013-04-29 | 2014-11-06 | F. Hoffmann-La Roche Ag | Human fcrn-binding modified antibodies and methods of use |
EP3628685A1 (en) | 2013-04-29 | 2020-04-01 | F. Hoffmann-La Roche AG | Human fcrn-binding modified antibodies and methods of use |
EP3878866A1 (en) | 2013-04-29 | 2021-09-15 | F. Hoffmann-La Roche AG | Fc-receptor binding modified asymmetric antibodies and methods of use |
WO2014177461A1 (en) | 2013-04-29 | 2014-11-06 | F. Hoffmann-La Roche Ag | Fcrn-binding abolished anti-igf-1r antibodies and their use in the treatment of vascular eye diseases |
EP3693385A1 (en) | 2013-07-05 | 2020-08-12 | Genmab A/S | Humanized or chimeric cd3 antibodies |
WO2015001085A1 (en) | 2013-07-05 | 2015-01-08 | Genmab B.V. | Humanized or chimeric cd3 antibodies |
US11124576B2 (en) | 2013-09-27 | 2021-09-21 | Chungai Seiyaku Kabushiki Kaisha | Method for producing polypeptide heteromultimer |
US10323099B2 (en) | 2013-10-11 | 2019-06-18 | Hoffmann-La Roche Inc. | Multispecific domain exchanged common variable light chain antibodies |
US11325981B2 (en) | 2013-11-27 | 2022-05-10 | Zymeworks Inc. | Bispecific antigen-binding constructs targeting Her2 |
US11965036B2 (en) | 2013-11-27 | 2024-04-23 | Zymeworks Bc Inc. | Bispecific antigen-binding constructs targeting HER2 |
US10947319B2 (en) | 2013-11-27 | 2021-03-16 | Zymeworks Inc. | Bispecific antigen-binding constructs targeting HER2 |
US10640572B2 (en) | 2013-12-17 | 2020-05-05 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
US10174124B2 (en) | 2013-12-17 | 2019-01-08 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
US11732054B2 (en) | 2013-12-17 | 2023-08-22 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
US10865251B2 (en) | 2013-12-17 | 2020-12-15 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
US11530275B2 (en) | 2013-12-17 | 2022-12-20 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
US11186650B2 (en) | 2013-12-17 | 2021-11-30 | Genentech, Inc. | Anti-CD3 antibodies and methods of use |
US10465000B2 (en) | 2013-12-20 | 2019-11-05 | Hoffmann-La Roche Inc. | Humanized anti-Tau(pS422) antibodies and methods of use |
US10561737B2 (en) | 2014-01-03 | 2020-02-18 | Hoffmann-La Roche Inc. | Bispecific anti-hapten/anti-blood brain barrier receptor antibodies, complexes thereof and their use as blood brain barrier shuttles |
WO2015101586A1 (en) | 2014-01-03 | 2015-07-09 | F. Hoffmann-La Roche Ag | Bispecific anti-hapten/anti-blood brain barrier receptor antibodies, complexes thereof and their use as blood brain barrier shuttles |
WO2015101588A1 (en) | 2014-01-06 | 2015-07-09 | F. Hoffmann-La Roche Ag | Monovalent blood brain barrier shuttle modules |
WO2015104346A1 (en) | 2014-01-09 | 2015-07-16 | Genmab B.V. | Humanized or chimeric cd3 antibodies |
EP3835318A1 (en) | 2014-01-15 | 2021-06-16 | F. Hoffmann-La Roche AG | Fc-region variants with modified fcrn- and maintained protein a-binding properties |
WO2015107026A1 (en) | 2014-01-15 | 2015-07-23 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn- and maintained protein a-binding properties |
EP3514179A1 (en) | 2014-01-24 | 2019-07-24 | Dana-Farber Cancer Institute, Inc. | Antibody molecules to pd-1 and uses thereof |
EP4324518A2 (en) | 2014-01-31 | 2024-02-21 | Novartis AG | Antibody molecules to tim-3 and uses thereof |
US11820825B2 (en) | 2014-02-28 | 2023-11-21 | Merus N.V. | Methods of treating a subject having an EGFR-positive and/or ErbB-3-positive tumor |
US11279770B2 (en) | 2014-02-28 | 2022-03-22 | Merus N.V. | Antibody that binds ErbB-2 and ErbB-3 |
US10844127B2 (en) | 2014-02-28 | 2020-11-24 | Merus N.V. | Antibodies that bind EGFR and ErbB3 |
EP3660050A1 (en) | 2014-03-14 | 2020-06-03 | Novartis AG | Antibody molecules to lag-3 and uses thereof |
WO2015138920A1 (en) | 2014-03-14 | 2015-09-17 | Novartis Ag | Antibody molecules to lag-3 and uses thereof |
WO2015142675A2 (en) | 2014-03-15 | 2015-09-24 | Novartis Ag | Treatment of cancer using chimeric antigen receptor |
US9822186B2 (en) | 2014-03-28 | 2017-11-21 | Xencor, Inc. | Bispecific antibodies that bind to CD38 and CD3 |
US10858451B2 (en) | 2014-03-28 | 2020-12-08 | Xencor, Inc. | Bispecific antibodies that bind to CD38 and CD3 |
US11840579B2 (en) | 2014-03-28 | 2023-12-12 | Xencor, Inc. | Bispecific antibodies that bind to CD38 and CD3 |
EP3590968A1 (en) | 2014-04-02 | 2020-01-08 | F. Hoffmann-La Roche AG | Multispecific antibodies |
WO2015150447A1 (en) | 2014-04-02 | 2015-10-08 | F. Hoffmann-La Roche Ag | Multispecific antibodies |
WO2015150446A1 (en) | 2014-04-02 | 2015-10-08 | F. Hoffmann-La Roche Ag | Method for detecting multispecific antibody light chain mispairing |
US11306156B2 (en) | 2014-05-28 | 2022-04-19 | Zymeworks Inc. | Modified antigen binding polypeptide constructs and uses thereof |
US11673968B2 (en) | 2014-06-26 | 2023-06-13 | Hoffmann-La Roche Inc. | Anti-BRDU antibodies and methods of use |
US10251952B2 (en) | 2014-06-26 | 2019-04-09 | Hoffmann-La Roche Inc. | Humanized anti-tau(pS422) antibody brain shuttles and use thereof |
EP3763738A1 (en) | 2014-07-11 | 2021-01-13 | Genmab A/S | Antibodies binding axl |
WO2016005593A1 (en) | 2014-07-11 | 2016-01-14 | Genmab A/S | Antibodies binding axl |
WO2016014553A1 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Sortase synthesized chimeric antigen receptors |
WO2016014565A2 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Treatment of cancer using humanized anti-bcma chimeric antigen receptor |
WO2016014530A1 (en) | 2014-07-21 | 2016-01-28 | Novartis Ag | Combinations of low, immune enhancing. doses of mtor inhibitors and cars |
EP3722316A1 (en) | 2014-07-21 | 2020-10-14 | Novartis AG | Treatment of cancer using a cd33 chimeric antigen receptor |
EP3660042A1 (en) | 2014-07-31 | 2020-06-03 | Novartis AG | Subset-optimized chimeric antigen receptor-containing t-cells |
EP4205749A1 (en) | 2014-07-31 | 2023-07-05 | Novartis AG | Subset-optimized chimeric antigen receptor-containing cells |
EP3608337A1 (en) | 2014-08-04 | 2020-02-12 | F. Hoffmann-La Roche AG | Bispecific t cell activating antigen binding molecules |
EP2982692A1 (en) | 2014-08-04 | 2016-02-10 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
US10611841B2 (en) | 2014-08-04 | 2020-04-07 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
US11117965B2 (en) | 2014-08-04 | 2021-09-14 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
US9914776B2 (en) | 2014-08-04 | 2018-03-13 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
US10611840B2 (en) | 2014-08-04 | 2020-04-07 | Hoffman-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
US10253104B2 (en) | 2014-08-04 | 2019-04-09 | Engmab Ag | Bispecific antibodies against CD3ϵ and BCMA |
EP2982694A1 (en) | 2014-08-04 | 2016-02-10 | EngMab AG | Bispecific antibodies against cd3epsilon and bcma |
WO2016020332A1 (en) | 2014-08-04 | 2016-02-11 | Engmab Ag | Bispecific antibodies against cd3epsilon and bcma |
WO2016025880A1 (en) | 2014-08-14 | 2016-02-18 | Novartis Ag | Treatment of cancer using gfr alpha-4 chimeric antigen receptor |
EP3712171A1 (en) | 2014-08-19 | 2020-09-23 | Novartis AG | Treatment of cancer using a cd123 chimeric antigen receptor |
US11084877B2 (en) | 2014-09-12 | 2021-08-10 | Genentech, Inc. | Anti-CLL-1 antibodies and immunoconjugates |
WO2016044605A1 (en) | 2014-09-17 | 2016-03-24 | Beatty, Gregory | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
EP3967709A1 (en) | 2014-09-17 | 2022-03-16 | Novartis AG | Targeting cytotoxic cells with chimeric receptors for adoptive immunotherapy |
US11952421B2 (en) | 2014-10-09 | 2024-04-09 | Bristol-Myers Squibb Company | Bispecific antibodies against CD3EPSILON and ROR1 |
WO2016055592A1 (en) | 2014-10-09 | 2016-04-14 | Engmab Ag | Bispecific antibodies against cd3epsilon and ror1 |
WO2016061142A1 (en) | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
EP4245376A2 (en) | 2014-10-14 | 2023-09-20 | Novartis AG | Antibody molecules to pd-l1 and uses thereof |
US11773166B2 (en) | 2014-11-04 | 2023-10-03 | Ichnos Sciences SA | CD3/CD38 T cell retargeting hetero-dimeric immunoglobulins and methods of their production |
EP3611188A1 (en) | 2014-11-06 | 2020-02-19 | F. Hoffmann-La Roche AG | Fc-region variants with modified fcrn-binding and methods of use |
EP3842453A1 (en) | 2014-11-06 | 2021-06-30 | F. Hoffmann-La Roche AG | Fc-region variants with modified fcrn- and protein a-binding properties |
US10781262B2 (en) | 2014-11-20 | 2020-09-22 | Hoffmann-La Roche Inc. | Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists |
EP3023437A1 (en) | 2014-11-20 | 2016-05-25 | EngMab AG | Bispecific antibodies against CD3epsilon and BCMA |
US11613587B2 (en) | 2014-11-20 | 2023-03-28 | Hoffmann-La Roche Inc. | Combination therapy of T cell activating bispecific antigen binding molecules and PD-1 axis binding antagonists |
US11225528B2 (en) | 2014-11-26 | 2022-01-18 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US10913803B2 (en) | 2014-11-26 | 2021-02-09 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US9856327B2 (en) | 2014-11-26 | 2018-01-02 | Xencor, Inc. | Heterodimeric antibodies to CD3 X CD123 |
US11859011B2 (en) | 2014-11-26 | 2024-01-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US11352442B2 (en) | 2014-11-26 | 2022-06-07 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CD38 |
US9850320B2 (en) | 2014-11-26 | 2017-12-26 | Xencor, Inc. | Heterodimeric antibodies to CD3 X CD20 |
US10526417B2 (en) | 2014-11-26 | 2020-01-07 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CD38 |
US10889653B2 (en) | 2014-11-26 | 2021-01-12 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US11673972B2 (en) | 2014-11-26 | 2023-06-13 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US11945880B2 (en) | 2014-11-26 | 2024-04-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US10259887B2 (en) | 2014-11-26 | 2019-04-16 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US11111315B2 (en) | 2014-11-26 | 2021-09-07 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
US11999801B2 (en) | 2014-12-03 | 2024-06-04 | Hoffman-La Roche Inc. | Multispecific antibodies |
US10633457B2 (en) | 2014-12-03 | 2020-04-28 | Hoffmann-La Roche Inc. | Multispecific antibodies |
WO2016090034A2 (en) | 2014-12-03 | 2016-06-09 | Novartis Ag | Methods for b cell preconditioning in car therapy |
US10982008B2 (en) | 2014-12-05 | 2021-04-20 | Merck Patent Gmbh | Domain-exchanged antibody |
CN107207592A (en) * | 2014-12-05 | 2017-09-26 | 默克专利有限公司 | The antibody of Domain swapping |
IL252004B2 (en) * | 2014-12-05 | 2023-02-01 | Merck Patent Gmbh | Domain-exchanged antibody |
IL252004B (en) * | 2014-12-05 | 2022-10-01 | Merck Patent Gmbh | Domain-exchanged antibody |
WO2016087650A1 (en) * | 2014-12-05 | 2016-06-09 | Merck Patent Gmbh | Domain-exchanged antibody |
US10865253B2 (en) | 2014-12-19 | 2020-12-15 | Genmab A/S | Rodent bispecific heterodimeric proteins |
US10428155B2 (en) | 2014-12-22 | 2019-10-01 | Xencor, Inc. | Trispecific antibodies |
US11091548B2 (en) | 2015-03-05 | 2021-08-17 | Xencor, Inc. | Modulation of T cells with bispecific antibodies and Fc fusions |
US10227411B2 (en) | 2015-03-05 | 2019-03-12 | Xencor, Inc. | Modulation of T cells with bispecific antibodies and FC fusions |
US11142587B2 (en) | 2015-04-01 | 2021-10-12 | Chugai Seiyaku Kabushiki Kaisha | Method for producing polypeptide hetero-oligomer |
EP4056588A1 (en) | 2015-04-08 | 2022-09-14 | Novartis AG | Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car)- expressing cell |
WO2016164731A2 (en) | 2015-04-08 | 2016-10-13 | Novartis Ag | Cd20 therapies, cd22 therapies, and combination therapies with a cd19 chimeric antigen receptor (car) - expressing cell |
WO2016172583A1 (en) | 2015-04-23 | 2016-10-27 | Novartis Ag | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
US11858991B2 (en) | 2015-06-08 | 2024-01-02 | Macrogenics, Inc. | LAG-3-binding molecules and methods of use thereof |
EP4303235A2 (en) | 2015-06-08 | 2024-01-10 | MacroGenics, Inc. | Lag-3-binding moleculkes and methods of use thereof |
US11072653B2 (en) | 2015-06-08 | 2021-07-27 | Macrogenics, Inc. | LAG-3-binding molecules and methods of use thereof |
US11466087B2 (en) | 2015-06-16 | 2022-10-11 | Genentech, Inc. | Anti-CLL-1 antibodies and methods of use |
US10501545B2 (en) | 2015-06-16 | 2019-12-10 | Genentech, Inc. | Anti-CLL-1 antibodies and methods of use |
US11192950B2 (en) | 2015-06-16 | 2021-12-07 | Genentech, Inc. | Humanized and affinity matured antibodies to FcRH5 and methods of use |
US10323094B2 (en) | 2015-06-16 | 2019-06-18 | Genentech, Inc. | Humanized and affinity matured antibodies to FcRH5 and methods of use |
US10822402B2 (en) | 2015-06-24 | 2020-11-03 | Hoffmann-La Roche Inc. | Humanized anti-tau(pS422) antibodies and methods of use |
WO2017005649A1 (en) | 2015-07-09 | 2017-01-12 | Genmab A/S | Bispecific and multispecific antibodies and method for isolation of such |
EP3730520A1 (en) | 2015-07-10 | 2020-10-28 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
US9914777B2 (en) | 2015-07-10 | 2018-03-13 | Merus N.V. | Human CD3 binding antibody |
WO2017009258A1 (en) | 2015-07-10 | 2017-01-19 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
US11739148B2 (en) | 2015-07-10 | 2023-08-29 | Merus N.V. | Human CD3 binding antibody |
US10266593B2 (en) | 2015-07-10 | 2019-04-23 | Merus N.V. | Human CD3 binding antibody |
US11359015B2 (en) | 2015-07-15 | 2022-06-14 | Genmab A/S | Humanized or chimeric CD3 antibodies |
EP3964528A1 (en) | 2015-07-29 | 2022-03-09 | Novartis AG | Combination therapies comprising antibody molecules to lag-3 |
WO2017019897A1 (en) | 2015-07-29 | 2017-02-02 | Novartis Ag | Combination therapies comprising antibody molecules to tim-3 |
WO2017019894A1 (en) | 2015-07-29 | 2017-02-02 | Novartis Ag | Combination therapies comprising antibody molecules to lag-3 |
EP3878465A1 (en) | 2015-07-29 | 2021-09-15 | Novartis AG | Combination therapies comprising antibody molecules to tim-3 |
US11623959B2 (en) | 2015-07-30 | 2023-04-11 | Macrogenics, Inc. | PD-1-binding molecules and methods of use thereof |
WO2017019846A1 (en) | 2015-07-30 | 2017-02-02 | Macrogenics, Inc. | Pd-1-binding molecules and methods use thereof |
EP3981792A1 (en) | 2015-07-30 | 2022-04-13 | MacroGenics, Inc. | Pd-1-binding molecules and methods of use thereof |
US10577422B2 (en) | 2015-07-30 | 2020-03-03 | Macrogenics, Inc. | PD-1-binding molecules and methods of use thereof |
EP3456346A1 (en) | 2015-07-30 | 2019-03-20 | MacroGenics, Inc. | Pd-1 and lag-3 binding molecules and methods of use thereof |
US11286300B2 (en) | 2015-10-01 | 2022-03-29 | Hoffmann-La Roche Inc. | Humanized anti-human CD19 antibodies and methods of use |
WO2017055395A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xrob04 bispecific t cell activating antigen binding molecules |
WO2017055393A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xtim-3 bispecific t cell activating antigen binding molecules |
WO2017055385A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xgd2 bispecific t cell activating antigen binding molecules |
US10766967B2 (en) | 2015-10-02 | 2020-09-08 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
EP3150637A1 (en) | 2015-10-02 | 2017-04-05 | F. Hoffmann-La Roche AG | Multispecific antibodies |
WO2017055388A2 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules |
WO2017055404A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific antibodies specific for pd1 and tim3 |
WO2017055399A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Cellular based fret assay for the determination of simultaneous binding |
EP3913000A1 (en) | 2015-10-02 | 2021-11-24 | F. Hoffmann-La Roche AG | Bispecific anti-cd19xcd3 t cell activating antigen binding molecules |
WO2017055391A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules binding mesothelin and cd3 |
WO2017055389A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific anti-ceaxcd3 t cell activating antigen binding molecules |
WO2017055392A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Anti-cd3xcd44v6 bispecific t cell activating antigen binding molecules |
WO2017055314A1 (en) | 2015-10-02 | 2017-04-06 | F. Hoffmann-La Roche Ag | Bispecific anti-cd19xcd3 t cell activating antigen binding molecules |
US11174315B2 (en) | 2015-10-08 | 2021-11-16 | Macrogenics, Inc. | Combination therapy for the treatment of cancer |
US11161915B2 (en) | 2015-10-08 | 2021-11-02 | Zymeworks Inc. | Antigen-binding polypeptide constructs comprising kappa and lambda light chains and uses thereof |
US11939394B2 (en) | 2015-10-23 | 2024-03-26 | Merus N.V. | Binding molecules that inhibit cancer growth |
WO2017072210A1 (en) | 2015-10-29 | 2017-05-04 | F. Hoffmann-La Roche Ag | Anti-variant fc-region antibodies and methods of use |
WO2017076492A1 (en) | 2015-11-03 | 2017-05-11 | Merck Patent Gmbh | Bi-specific antibodies for enhanced tumor selectivity and inhibition and uses thereof |
EP3909984A1 (en) | 2015-11-03 | 2021-11-17 | Merck Patent GmbH | Affinity matured c-met antibodies |
US11235063B2 (en) | 2015-11-03 | 2022-02-01 | Merck Patent Gmbh | Bi-specific antibodies for enhanced tumor selectivity and inhibition and uses thereof |
CN108350078A (en) * | 2015-11-03 | 2018-07-31 | 默克专利股份公司 | Bispecific antibody and application thereof for improving tumor-selective and inhibition |
US10227410B2 (en) | 2015-12-07 | 2019-03-12 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and PSMA |
US11623957B2 (en) | 2015-12-07 | 2023-04-11 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and PSMA |
US11013801B2 (en) | 2015-12-09 | 2021-05-25 | Hoffmann-La Roche Inc. | Treatment method |
EP4026848A1 (en) | 2015-12-09 | 2022-07-13 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody for reducing the cytokine release syndrome |
EP3178848A1 (en) | 2015-12-09 | 2017-06-14 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody for reducing formation of anti-drug antibodies |
US11840571B2 (en) | 2015-12-14 | 2023-12-12 | Macrogenics, Inc. | Methods of using bispecific molecules having immunoreactivity with PD-1 and CTLA-4 |
US10954301B2 (en) | 2015-12-14 | 2021-03-23 | Macrogenics, Inc. | Bispecific molecules having immunoreactivity with PD-1 and CTLA-4, and methods of use thereof |
WO2017106061A1 (en) | 2015-12-14 | 2017-06-22 | Macrogenics, Inc. | Bispecific molecules having immunoreactivity with pd-1 and ctla-4, and methods of use thereof |
WO2017106656A1 (en) | 2015-12-17 | 2017-06-22 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
WO2017106810A2 (en) | 2015-12-17 | 2017-06-22 | Novartis Ag | Combination of c-met inhibitor with antibody molecule to pd-1 and uses thereof |
EP3862365A1 (en) | 2016-01-08 | 2021-08-11 | F. Hoffmann-La Roche AG | Methods of treating cea-positive cancers using pd-1 axis binding antagonists and anti-cea/anti-cd3 bispecific antibodies |
US10596257B2 (en) | 2016-01-08 | 2020-03-24 | Hoffmann-La Roche Inc. | Methods of treating CEA-positive cancers using PD-1 axis binding antagonists and anti-CEA/anti-CD3 bispecific antibodies |
WO2017121877A1 (en) | 2016-01-13 | 2017-07-20 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
EP3851457A1 (en) | 2016-01-21 | 2021-07-21 | Novartis AG | Multispecific molecules targeting cll-1 |
WO2017125897A1 (en) | 2016-01-21 | 2017-07-27 | Novartis Ag | Multispecific molecules targeting cll-1 |
WO2017142928A1 (en) | 2016-02-17 | 2017-08-24 | Macrogenics, Inc. | Ror1-binding molecules, and methods of use thereof |
WO2017149515A1 (en) | 2016-03-04 | 2017-09-08 | Novartis Ag | Cells expressing multiple chimeric antigen receptor (car) molecules and uses therefore |
US11242390B2 (en) | 2016-03-22 | 2022-02-08 | Hoffmann-La Roche Inc. | Protease-activated T cell bispecific molecules |
WO2017165683A1 (en) | 2016-03-23 | 2017-09-28 | Novartis Ag | Cell secreted minibodies and uses thereof |
WO2017181119A2 (en) | 2016-04-15 | 2017-10-19 | Novartis Ag | Compositions and methods for selective protein expression |
EP4219721A2 (en) | 2016-04-15 | 2023-08-02 | Novartis AG | Compositions and methods for selective protein expression |
US10961311B2 (en) | 2016-04-15 | 2021-03-30 | Macrogenics, Inc. | B7-H3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
WO2017180813A1 (en) | 2016-04-15 | 2017-10-19 | Macrogenics, Inc. | Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof |
US11591400B2 (en) | 2016-04-15 | 2023-02-28 | Macrogenics, Inc. | B7-H3 directed antibody drug conjugates |
WO2017184832A1 (en) | 2016-04-20 | 2017-10-26 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for making antibodies based on use of expression-enhancing loci |
US11512144B2 (en) | 2016-04-20 | 2022-11-29 | Regeneran Pharmaceuticals, Inc. | Compositions and methods for making antibodies based on use of an expression-enhancing loci |
US11530277B2 (en) | 2016-04-20 | 2022-12-20 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for making antibodies based on use of an expression-enhancing locus |
WO2017184831A1 (en) | 2016-04-20 | 2017-10-26 | Regeneron Pharmaceuticals, Inc. | Compositions and methods for making antibodies based on use of an expression-enhancing locus |
EP3889175A1 (en) | 2016-05-02 | 2021-10-06 | F. Hoffmann-La Roche AG | The contorsbody - a single chain target binder |
WO2017191101A1 (en) | 2016-05-02 | 2017-11-09 | F. Hoffmann-La Roche Ag | The contorsbody - a single chain target binder |
WO2017210617A2 (en) | 2016-06-02 | 2017-12-07 | Porter, David, L. | Therapeutic regimens for chimeric antigen receptor (car)- expressing cells |
EP3252078A1 (en) | 2016-06-02 | 2017-12-06 | F. Hoffmann-La Roche AG | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
US11236170B2 (en) | 2016-06-14 | 2022-02-01 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
US11492407B2 (en) | 2016-06-14 | 2022-11-08 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
US10787518B2 (en) | 2016-06-14 | 2020-09-29 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
US11225521B2 (en) | 2016-06-28 | 2022-01-18 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
US10316088B2 (en) | 2016-06-28 | 2019-06-11 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
WO2018007314A1 (en) | 2016-07-04 | 2018-01-11 | F. Hoffmann-La Roche Ag | Novel antibody format |
WO2018011421A1 (en) | 2016-07-14 | 2018-01-18 | Genmab A/S | Multispecific antibodies against cd40 and cd137 |
WO2018013918A2 (en) | 2016-07-15 | 2018-01-18 | Novartis Ag | Treatment and prevention of cytokine release syndrome using a chimeric antigen receptor in combination with a kinase inhibitor |
WO2018023025A1 (en) | 2016-07-28 | 2018-02-01 | Novartis Ag | Combination therapies of chimeric antigen receptors adn pd-1 inhibitors |
WO2018026819A2 (en) | 2016-08-01 | 2018-02-08 | Novartis Ag | Treatment of cancer using a chimeric antigen receptor in combination with an inhibitor of a pro-m2 macrophage molecule |
US10793632B2 (en) | 2016-08-30 | 2020-10-06 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
IL265362B1 (en) * | 2016-09-14 | 2024-01-01 | Merck Patent Gmbh | Anti-c-met antibodies and such antibody drug conjugates |
CN109937211A (en) * | 2016-09-14 | 2019-06-25 | 默克专利股份公司 | Anti- c-MET antibody and its antibody drug conjugates for effective tumor suppression |
IL265362B2 (en) * | 2016-09-14 | 2024-05-01 | Merck Patent Gmbh | Anti-c-met antibodies and such antibody drug conjugates |
WO2018050733A1 (en) | 2016-09-14 | 2018-03-22 | Merck Patent Gmbh | Anti-c-met antibodies and antibody drug conjugates thereof for efficient tumor inhibition |
US10738120B2 (en) | 2016-09-20 | 2020-08-11 | Merck Patent Gmbh | Diagnostic anti-PD-L1 antibody and use thereof |
WO2018054940A1 (en) | 2016-09-20 | 2018-03-29 | Merck Patent Gmbh | Diagnostic anti-pd-l1 antibody and use thereof |
WO2018060301A1 (en) | 2016-09-30 | 2018-04-05 | F. Hoffmann-La Roche Ag | Bispecific antibodies against cd3 |
US10882918B2 (en) | 2016-09-30 | 2021-01-05 | Hoffmann-La Roche Inc. | Bispecific T cell activating antigen binding molecules |
WO2018060035A1 (en) | 2016-09-30 | 2018-04-05 | F. Hoffmann-La Roche Ag | Spr-based dual-binding assay for the functional analysis of multispecific molecules |
WO2018067992A1 (en) | 2016-10-07 | 2018-04-12 | Novartis Ag | Chimeric antigen receptors for the treatment of cancer |
US10550185B2 (en) | 2016-10-14 | 2020-02-04 | Xencor, Inc. | Bispecific heterodimeric fusion proteins containing IL-15-IL-15Rα Fc-fusion proteins and PD-1 antibody fragments |
US11584794B2 (en) | 2016-10-14 | 2023-02-21 | Xencor, Inc. | Bispecific heterodimeric fusion proteins containing IL-15-IL-15Ralpha Fc-fusion proteins and immune checkpoint antibody fragments |
US10501543B2 (en) | 2016-10-14 | 2019-12-10 | Xencor, Inc. | IL15/IL15Rα heterodimeric Fc-fusion proteins |
WO2018083126A1 (en) | 2016-11-01 | 2018-05-11 | Genmab B.V. | Polypeptide variants and uses thereof |
US11466094B2 (en) | 2016-11-15 | 2022-10-11 | Genentech, Inc. | Dosing for treatment with anti-CD20/anti-CD3 bispecific antibodies |
US11981737B2 (en) | 2016-11-18 | 2024-05-14 | Hoffmann-La Roche Inc. | Anti-HLA-G antibodies and use thereof |
US11242402B2 (en) | 2016-12-23 | 2022-02-08 | Macrogenics, Inc. | ADAM9-binding molecules, and methods of use thereof |
EP4043485A1 (en) | 2017-01-26 | 2022-08-17 | Novartis AG | Cd28 compositions and methods for chimeric antigen receptor therapy |
WO2018141894A1 (en) | 2017-02-02 | 2018-08-09 | Merck Patent Gmbh | Preferred pairing of antibody domains |
WO2018146317A1 (en) | 2017-02-10 | 2018-08-16 | Genmab B.V. | Polypeptide variants and uses thereof |
WO2018155611A1 (en) | 2017-02-24 | 2018-08-30 | 中外製薬株式会社 | Pharmaceutical composition, antigen-binding molecules, treatment method, and screening method |
WO2018158719A1 (en) | 2017-03-02 | 2018-09-07 | Novartis Ag | Engineered heterodimeric proteins |
WO2018162749A1 (en) | 2017-03-09 | 2018-09-13 | Genmab A/S | Antibodies against pd-l1 |
WO2018162517A1 (en) | 2017-03-10 | 2018-09-13 | F. Hoffmann-La Roche Ag | Method for producing multispecific antibodies |
US11780925B2 (en) | 2017-03-31 | 2023-10-10 | Merus N.V. | ErbB-2 and ErbB3 binding bispecific antibodies for use in the treatment of cells that have an NRG1 fusion gene |
WO2018178396A1 (en) | 2017-03-31 | 2018-10-04 | Genmab Holding B.V. | Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof |
WO2018184964A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Immunoconjugates of an anti-pd-1 antibody with a mutant il-2 or with il-15 |
US11685790B2 (en) | 2017-04-03 | 2023-06-27 | Hoffmann-La Roche Inc. | Antibodies binding to STEAP-1 |
WO2018184965A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Immunoconjugates of il-2 with an anti-pd-1 and tim-3 bispecific antibody |
WO2018184966A1 (en) | 2017-04-03 | 2018-10-11 | F. Hoffmann-La Roche Ag | Antibodies binding to steap-1 |
WO2018187227A1 (en) | 2017-04-03 | 2018-10-11 | Concologie, Inc. | Methods for treating cancer using ps-targeting antibodies with immuno-oncology agents |
US11180571B2 (en) | 2017-04-03 | 2021-11-23 | Hoffmann-La Roche Inc. | Antibodies binding to STEAP-1 |
WO2018185043A1 (en) | 2017-04-05 | 2018-10-11 | F. Hoffmann-La Roche Ag | Bispecific antibodies specifically binding to pd1 and lag3 |
WO2018189220A1 (en) | 2017-04-13 | 2018-10-18 | F. Hoffmann-La Roche Ag | An interleukin-2 immunoconjugate, a cd40 agonist, and optionally a pd-1 axis binding antagonist for use in methods of treating cancer |
WO2018201051A1 (en) | 2017-04-28 | 2018-11-01 | Novartis Ag | Bcma-targeting agent, and combination therapy with a gamma secretase inhibitor |
WO2018201056A1 (en) | 2017-04-28 | 2018-11-01 | Novartis Ag | Cells expressing a bcma-targeting chimeric antigen receptor, and combination therapy with a gamma secretase inhibitor |
WO2018220099A1 (en) | 2017-06-02 | 2018-12-06 | F. Hoffmann-La Roche Ag | Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer |
WO2018224609A1 (en) | 2017-06-07 | 2018-12-13 | Genmab B.V. | Therapeutic antibodies based on mutated igg hexamers |
US11919969B2 (en) | 2017-06-22 | 2024-03-05 | Kymab Limited | Bispecific antibodies for factor IX and factor X |
WO2018237157A1 (en) | 2017-06-22 | 2018-12-27 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
WO2018234575A1 (en) | 2017-06-22 | 2018-12-27 | Kymab Limited | Bispecific antibodies for factor ix and factor x |
WO2019006007A1 (en) | 2017-06-27 | 2019-01-03 | Novartis Ag | Dosage regimens for anti-tim-3 antibodies and uses thereof |
US11084863B2 (en) | 2017-06-30 | 2021-08-10 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains |
WO2019014091A1 (en) | 2017-07-10 | 2019-01-17 | Eli Lilly And Company | Checkpoint inhibitor bispecific antibodies |
US11752207B2 (en) | 2017-07-11 | 2023-09-12 | Compass Therapeutics Llc | Agonist antibodies that bind human CD137 and uses thereof |
WO2019018730A1 (en) | 2017-07-20 | 2019-01-24 | Novartis Ag | Dosage regimens of anti-lag-3 antibodies and uses thereof |
WO2019025545A1 (en) | 2017-08-04 | 2019-02-07 | Genmab A/S | Binding agents binding to pd-l1 and cd137 and use thereof |
US11773170B2 (en) | 2017-08-09 | 2023-10-03 | Merus N.V. | Antibodies that bind EGFR and cMET |
WO2019077092A1 (en) | 2017-10-20 | 2019-04-25 | F. Hoffmann-La Roche Ag | Method for generating multispecific antibodies from monospecific antibodies |
WO2019086362A1 (en) | 2017-10-30 | 2019-05-09 | F. Hoffmann-La Roche Ag | Method for in vivo generation of multispecific antibodies from monospecific antibodies |
US11718679B2 (en) | 2017-10-31 | 2023-08-08 | Compass Therapeutics Llc | CD137 antibodies and PD-1 antagonists and uses thereof |
WO2019086395A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Trifab-contorsbody |
WO2019086394A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | The compbody - a multivalent target binder |
WO2019086500A2 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Bispecific 2+1 contorsbodies |
WO2019086499A1 (en) | 2017-11-01 | 2019-05-09 | F. Hoffmann-La Roche Ag | Novel tnf family ligand trimer-containing antigen binding molecules |
US10981992B2 (en) | 2017-11-08 | 2021-04-20 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
US11312770B2 (en) | 2017-11-08 | 2022-04-26 | Xencor, Inc. | Bispecific and monospecific antibodies using novel anti-PD-1 sequences |
WO2019099838A1 (en) | 2017-11-16 | 2019-05-23 | Novartis Ag | Combination therapies |
US11795226B2 (en) | 2017-12-12 | 2023-10-24 | Macrogenics, Inc. | Bispecific CD16-binding molecules and their use in the treatment of disease |
US11319355B2 (en) | 2017-12-19 | 2022-05-03 | Xencor, Inc. | Engineered IL-2 Fc fusion proteins |
WO2019122052A2 (en) | 2017-12-21 | 2019-06-27 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/wt1 |
US11192957B2 (en) | 2017-12-21 | 2021-12-07 | Hoffmann-La Roche Inc. | Antibodies binding to HLA-A2/WT1 |
WO2019122054A1 (en) | 2017-12-22 | 2019-06-27 | F. Hoffmann-La Roche Ag | Depletion of light chain mispaired antibody variants by hydrophobic interaction chromatography |
WO2019145455A1 (en) | 2018-01-24 | 2019-08-01 | Genmab B.V. | Polypeptide variants and uses thereof |
WO2019152660A1 (en) | 2018-01-31 | 2019-08-08 | Novartis Ag | Combination therapy using a chimeric antigen receptor |
WO2019154776A1 (en) | 2018-02-06 | 2019-08-15 | F. Hoffmann-La Roche Ag | Treatment of ophthalmologic diseases |
US11866498B2 (en) | 2018-02-08 | 2024-01-09 | Genentech, Inc. | Bispecific antigen-binding molecules and methods of use |
WO2019154890A1 (en) | 2018-02-09 | 2019-08-15 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2019160007A1 (en) | 2018-02-14 | 2019-08-22 | 中外製薬株式会社 | Antigen-binding molecule and combination |
US11685781B2 (en) | 2018-02-15 | 2023-06-27 | Macrogenics, Inc. | Variant CD3-binding domains and their use in combination therapies for the treatment of disease |
WO2019175198A2 (en) | 2018-03-12 | 2019-09-19 | Genmab A/S | Antibodies |
US10982006B2 (en) | 2018-04-04 | 2021-04-20 | Xencor, Inc. | Heterodimeric antibodies that bind fibroblast activation protein |
WO2019200229A1 (en) | 2018-04-13 | 2019-10-17 | Novartis Ag | Dosage regimens for anti-pd-l1 antibodies and uses thereof |
WO2019202041A1 (en) | 2018-04-18 | 2019-10-24 | F. Hoffmann-La Roche Ag | Multispecific antibodies and use thereof |
US11505595B2 (en) | 2018-04-18 | 2022-11-22 | Xencor, Inc. | TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains |
US11524991B2 (en) | 2018-04-18 | 2022-12-13 | Xencor, Inc. | PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof |
WO2019210153A1 (en) | 2018-04-27 | 2019-10-31 | Novartis Ag | Car t cell therapies with enhanced efficacy |
WO2019211472A1 (en) | 2018-05-03 | 2019-11-07 | Genmab B.V. | Antibody variant combinations and uses thereof |
WO2019226658A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Multispecific antigen-binding compositions and methods of use |
WO2019226617A1 (en) | 2018-05-21 | 2019-11-28 | Compass Therapeutics Llc | Compositions and methods for enhancing the killing of target cells by nk cells |
WO2019227003A1 (en) | 2018-05-25 | 2019-11-28 | Novartis Ag | Combination therapy with chimeric antigen receptor (car) therapies |
WO2019232244A2 (en) | 2018-05-31 | 2019-12-05 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
WO2019241426A1 (en) | 2018-06-13 | 2019-12-19 | Novartis Ag | Bcma chimeric antigen receptors and uses thereof |
WO2019246293A2 (en) | 2018-06-19 | 2019-12-26 | Atarga, Llc | Antibody molecules to complement component 5 and uses thereof |
WO2019243636A1 (en) | 2018-06-22 | 2019-12-26 | Genmab Holding B.V. | Anti-cd37 antibodies and anti-cd20 antibodies, compositions and methods of use thereof |
WO2020012337A1 (en) | 2018-07-10 | 2020-01-16 | Novartis Ag | 3-(5-amino-1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and their use in the treatment of i karos family zinc finger 2 (ikzf2)-dependent diseases |
WO2020012038A1 (en) | 2018-07-13 | 2020-01-16 | Genmab A/S | Trogocytosis-mediated therapy using cd38 antibodies |
WO2020012036A1 (en) | 2018-07-13 | 2020-01-16 | Genmab A/S | Variants of cd38 antibody and uses thereof |
WO2020021465A1 (en) | 2018-07-25 | 2020-01-30 | Advanced Accelerator Applications (Italy) S.R.L. | Method of treatment of neuroendocrine tumors |
WO2020045545A1 (en) | 2018-08-29 | 2020-03-05 | 中外製薬株式会社 | Antibody half-molecule, and method for inhibiting homodimer formation of antibody half-molecule |
WO2020049128A1 (en) | 2018-09-06 | 2020-03-12 | Kymab Limited | Antigen-binding molecules comprising unpaired variable domains |
US11667721B2 (en) | 2018-09-24 | 2023-06-06 | Medical College Of Wisconsin, Inc. | CD30 bispecific antibodies and method of immunotherapy of CD30+ malignancies |
WO2020068774A1 (en) | 2018-09-24 | 2020-04-02 | The Medical College Of Wisconsin, Inc. | System and method for the development of cd30 bispecific antibodies for immunotherapy of cd30+ malignancies |
US11358999B2 (en) | 2018-10-03 | 2022-06-14 | Xencor, Inc. | IL-12 heterodimeric Fc-fusion proteins |
WO2020070313A1 (en) | 2018-10-04 | 2020-04-09 | Genmab Holding B.V. | Pharmaceutical compositions comprising bispecific anti-cd37 antibodies |
US11377477B2 (en) | 2018-10-12 | 2022-07-05 | Xencor, Inc. | PD-1 targeted IL-15/IL-15RALPHA fc fusion proteins and uses in combination therapies thereof |
WO2020089051A1 (en) | 2018-10-29 | 2020-05-07 | F. Hoffmann-La Roche Ag | Antibody formulation |
WO2020094744A1 (en) | 2018-11-06 | 2020-05-14 | Genmab A/S | Antibody formulation |
US11970538B2 (en) | 2018-11-13 | 2024-04-30 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
US11046769B2 (en) | 2018-11-13 | 2021-06-29 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
WO2020115115A1 (en) | 2018-12-05 | 2020-06-11 | Morphosys Ag | Multispecific antigen-binding molecules |
WO2020128467A2 (en) | 2018-12-19 | 2020-06-25 | Kymab Limited | Antagonists |
WO2020128898A1 (en) | 2018-12-20 | 2020-06-25 | Novartis Ag | Pharmaceutical combinations |
US11618776B2 (en) | 2018-12-20 | 2023-04-04 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15/IL-15RA and NKG2D antigen binding domains |
WO2020128972A1 (en) | 2018-12-20 | 2020-06-25 | Novartis Ag | Dosing regimen and pharmaceutical combination comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
WO2020128049A1 (en) | 2018-12-21 | 2020-06-25 | Kymab Limited | Fixaxfx bispecific antibody with common light chain |
WO2020127619A1 (en) | 2018-12-21 | 2020-06-25 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
US11976135B2 (en) | 2018-12-21 | 2024-05-07 | Kymab Limited | FIXaxFX bispecific antibody with common light chain |
EP4015538A1 (en) | 2018-12-21 | 2022-06-22 | Kymab Limited | Fixaxfx bispecific antibody with common light chain |
WO2020136060A1 (en) | 2018-12-28 | 2020-07-02 | F. Hoffmann-La Roche Ag | A peptide-mhc-i-antibody fusion protein for therapeutic use in a patient with amplified immune response |
WO2020165868A1 (en) | 2019-02-15 | 2020-08-20 | Perkinelmer Cellular Technologies Germany Gmbh | Low-power microscope-objective pre-scan and high-power microscope-objective scan in x,y and z-direction for imaging objects such as cells using a microscope |
WO2020165833A1 (en) | 2019-02-15 | 2020-08-20 | Novartis Ag | 3-(1-oxo-5-(piperidin-4-yl)isoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
WO2020165834A1 (en) | 2019-02-15 | 2020-08-20 | Novartis Ag | Substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
WO2020172553A1 (en) | 2019-02-22 | 2020-08-27 | Novartis Ag | Combination therapies of egfrviii chimeric antigen receptors and pd-1 inhibitors |
US11472890B2 (en) | 2019-03-01 | 2022-10-18 | Xencor, Inc. | Heterodimeric antibodies that bind ENPP3 and CD3 |
WO2020200941A1 (en) | 2019-03-29 | 2020-10-08 | F. Hoffmann-La Roche Ag | Spr-based binding assay for the functional analysis of multivalent molecules |
WO2020200944A1 (en) | 2019-03-29 | 2020-10-08 | F. Hoffmann-La Roche Ag | Method for generating avid-binding multispecific antibodies |
WO2020205523A1 (en) | 2019-03-29 | 2020-10-08 | Atarga, Llc | Anti fgf23 antibody |
WO2020216878A1 (en) | 2019-04-25 | 2020-10-29 | F. Hoffmann-La Roche Ag | Generation of antibody-derived polypeptides by polypeptide chain exchange |
WO2020216879A1 (en) | 2019-04-25 | 2020-10-29 | F. Hoffmann-La Roche Ag | Therapeutic multispecific polypeptides activated by polypeptide chain exchange |
WO2020216883A1 (en) | 2019-04-25 | 2020-10-29 | F. Hoffmann-La Roche Ag | Activatable therapeutic multispecific polypeptides with extended half-life |
WO2020225456A1 (en) | 2019-05-09 | 2020-11-12 | Genmab B.V. | Dosage regimens for a combination of anti-dr5 antibodies for use in treating cancer |
WO2020229378A1 (en) | 2019-05-13 | 2020-11-19 | F. Hoffmann-La Roche Ag | Interference-suppressed pharmacokinetic immunoassay |
WO2020254357A1 (en) | 2019-06-19 | 2020-12-24 | F. Hoffmann-La Roche Ag | Method for the generation of a protein expressing cell by targeted integration using cre mrna |
WO2020260327A1 (en) | 2019-06-26 | 2020-12-30 | F. Hoffmann-La Roche Ag | Mammalian cell lines with sirt-1 gene knockout |
WO2021001289A1 (en) | 2019-07-02 | 2021-01-07 | F. Hoffmann-La Roche Ag | Immunoconjugates comprising a mutant interleukin-2 and an anti-cd8 antibody |
WO2021009146A1 (en) | 2019-07-15 | 2021-01-21 | F. Hoffmann-La Roche Ag | Antibodies binding to nkg2d |
WO2021018925A1 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
WO2021018859A2 (en) | 2019-07-31 | 2021-02-04 | F. Hoffmann-La Roche Ag | Antibodies binding to gprc5d |
US11932675B2 (en) | 2019-10-11 | 2024-03-19 | Genentech, Inc. | PD-1 targeted IL-15/IL-15Rα Fc fusion proteins with improved properties |
WO2021079188A1 (en) | 2019-10-21 | 2021-04-29 | Novartis Ag | Combination therapies with venetoclax and tim-3 inhibitors |
WO2021079195A1 (en) | 2019-10-21 | 2021-04-29 | Novartis Ag | Tim-3 inhibitors and uses thereof |
WO2021089850A1 (en) | 2019-11-06 | 2021-05-14 | Genmab B.V. | Antibody variant combinations and uses thereof |
WO2021108661A2 (en) | 2019-11-26 | 2021-06-03 | Novartis Ag | Chimeric antigen receptors and uses thereof |
US11845799B2 (en) | 2019-12-13 | 2023-12-19 | Genentech, Inc. | Anti-Ly6G6D antibodies and methods of use |
WO2021122875A1 (en) | 2019-12-18 | 2021-06-24 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a2/mage-a4 |
US11739142B2 (en) | 2019-12-18 | 2023-08-29 | Hoffmann-La Roche Inc. | Bispecific anti-CCL2 antibodies |
US11987632B2 (en) | 2019-12-18 | 2024-05-21 | Hoffmann-La Roche Inc. | Antibodies binding to HLA-A2/MAGE-A4 |
WO2021122733A1 (en) | 2019-12-18 | 2021-06-24 | F. Hoffmann-La Roche Ag | Bispecific anti-ccl2 antibodies |
WO2021123902A1 (en) | 2019-12-20 | 2021-06-24 | Novartis Ag | Combination of anti tim-3 antibody mbg453 and anti tgf-beta antibody nis793, with or without decitabine or the anti pd-1 antibody spartalizumab, for treating myelofibrosis and myelodysplastic syndrome |
WO2021123996A1 (en) | 2019-12-20 | 2021-06-24 | Novartis Ag | Uses of anti-tgf-beta antibodies and checkpoint inhibitors for the treatment of proliferative diseases |
WO2021136772A1 (en) | 2020-01-02 | 2021-07-08 | F. Hoffmann-La Roche Ag | Method for determining the amount of a therapeutic antibody in the brain |
WO2021144457A1 (en) | 2020-01-16 | 2021-07-22 | Genmab A/S | Formulations of cd38 antibodies and uses thereof |
WO2021144657A1 (en) | 2020-01-17 | 2021-07-22 | Novartis Ag | Combination comprising a tim-3 inhibitor and a hypomethylating agent for use in treating myelodysplastic syndrome or chronic myelomonocytic leukemia |
WO2021146636A1 (en) | 2020-01-17 | 2021-07-22 | Becton, Dickinson And Company | Methods and compositions for single cell secretomics |
WO2021156258A1 (en) | 2020-02-04 | 2021-08-12 | BioNTech SE | Treatment involving antigen vaccination and binding agents binding to pd-l1 and cd137 |
WO2021155916A1 (en) | 2020-02-04 | 2021-08-12 | BioNTech SE | Treatment involving antigen vaccination and binding agents binding to pd-l1 and cd137 |
WO2021173995A2 (en) | 2020-02-27 | 2021-09-02 | Novartis Ag | Methods of making chimeric antigen receptor-expressing cells |
WO2021185934A1 (en) | 2020-03-18 | 2021-09-23 | Genmab A/S | Antibodies binding to b7h4 |
US11261254B1 (en) | 2020-03-18 | 2022-03-01 | Genmab A/S | Antibodies |
WO2021190980A1 (en) | 2020-03-22 | 2021-09-30 | Quadrucept Bio Limited | Multimers for viral strain evolution |
WO2021194839A1 (en) | 2020-03-25 | 2021-09-30 | Eli Lilly And Company | Multispecific binding proteins and methods of developing the same |
WO2021211753A1 (en) | 2020-04-15 | 2021-10-21 | Voyager Therapeutics, Inc. | Tau binding compounds |
WO2021209402A2 (en) | 2020-04-15 | 2021-10-21 | F. Hoffmann-La Roche Ag | Immunoconjugates |
WO2021222552A1 (en) | 2020-04-30 | 2021-11-04 | Celgene Corporation | Methods of treating cytokine-related adverse events |
WO2021231278A1 (en) | 2020-05-11 | 2021-11-18 | F. Hoffmann-La Roche Ag | Combination therapy with modified pbmcs and an immunoconjugate |
US11919956B2 (en) | 2020-05-14 | 2024-03-05 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3 |
WO2021255138A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Immune activating fc domain binding molecules |
WO2021255143A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and folr1 |
WO2021255142A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 |
US11780920B2 (en) | 2020-06-19 | 2023-10-10 | Hoffmann-La Roche Inc. | Antibodies binding to CD3 and CD19 |
WO2021255155A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cd19 |
WO2021255146A1 (en) | 2020-06-19 | 2021-12-23 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and cea |
WO2021260528A1 (en) | 2020-06-23 | 2021-12-30 | Novartis Ag | Dosing regimen comprising 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives |
WO2022013787A1 (en) | 2020-07-16 | 2022-01-20 | Novartis Ag | Anti-betacellulin antibodies, fragments thereof, and multi-specific binding molecules |
WO2022018294A1 (en) | 2020-07-23 | 2022-01-27 | Genmab B.V. | A combination of anti-dr5 antibodies and an immunomodulatory imide drug for use in treating multiple myeloma |
WO2022026592A2 (en) | 2020-07-28 | 2022-02-03 | Celltas Bio, Inc. | Antibody molecules to coronavirus and uses thereof |
WO2022029573A1 (en) | 2020-08-03 | 2022-02-10 | Novartis Ag | Heteroaryl substituted 3-(1-oxoisoindolin-2-yl)piperidine-2,6-dione derivatives and uses thereof |
WO2022029011A1 (en) | 2020-08-06 | 2022-02-10 | BioNTech SE | Binding agents for coronavirus s protein |
US11591401B2 (en) | 2020-08-19 | 2023-02-28 | Xencor, Inc. | Anti-CD28 compositions |
US11919958B2 (en) | 2020-08-19 | 2024-03-05 | Xencor, Inc. | Anti-CD28 compositions |
WO2022043557A1 (en) | 2020-08-31 | 2022-03-03 | Advanced Accelerator Applications International Sa | Method of treating psma-expressing cancers |
WO2022043558A1 (en) | 2020-08-31 | 2022-03-03 | Advanced Accelerator Applications International Sa | Method of treating psma-expressing cancers |
WO2022049220A2 (en) | 2020-09-02 | 2022-03-10 | Genmab A/S | Antibody therapy |
US11845805B2 (en) | 2020-09-10 | 2023-12-19 | Genmab A/S | Bispecific antibody against CD3 and CD20 in combination therapy for treating diffuse large B-cell lymphoma |
US11858995B2 (en) | 2020-09-10 | 2024-01-02 | Genmab A/S | Bispecific antibodies against CD3 and CD20 for treating chronic lymphocytic leukemia |
WO2022063877A1 (en) | 2020-09-24 | 2022-03-31 | F. Hoffmann-La Roche Ag | Mammalian cell lines with gene knockout |
WO2022069724A1 (en) | 2020-10-02 | 2022-04-07 | Genmab A/S | Antibodies capable of binding to ror2 and bispecific antibodies binding to ror2 and cd3 |
WO2022097065A2 (en) | 2020-11-06 | 2022-05-12 | Novartis Ag | ANTIBODY Fc VARIANTS |
WO2022100613A1 (en) | 2020-11-10 | 2022-05-19 | 上海齐鲁制药研究中心有限公司 | Bispecific antibody for claudin 18a2 and cd3 and application of bispecific antibody |
WO2022104061A1 (en) | 2020-11-13 | 2022-05-19 | Novartis Ag | Combination therapies with chimeric antigen receptor (car)-expressing cells |
WO2022129120A1 (en) | 2020-12-17 | 2022-06-23 | F. Hoffmann-La Roche Ag | Anti-hla-g antibodies and use thereof |
WO2022129313A1 (en) | 2020-12-18 | 2022-06-23 | F. Hoffmann-La Roche Ag | Precursor proteins and kit for targeted therapy |
WO2022136140A1 (en) | 2020-12-22 | 2022-06-30 | F. Hoffmann-La Roche Ag | Oligonucleotides targeting xbp1 |
WO2022148732A1 (en) | 2021-01-06 | 2022-07-14 | F. Hoffmann-La Roche Ag | Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody |
WO2022148853A1 (en) | 2021-01-11 | 2022-07-14 | F. Hoffmann-La Roche Ag | Immunoconjugates |
WO2022162569A1 (en) | 2021-01-29 | 2022-08-04 | Novartis Ag | Dosage regimes for anti-cd73 and anti-entpd2 antibodies and uses thereof |
WO2022175217A1 (en) | 2021-02-18 | 2022-08-25 | F. Hoffmann-La Roche Ag | Method for resolving complex, multistep antibody interactions |
WO2022184659A1 (en) | 2021-03-01 | 2022-09-09 | Quadrucept Bio Limited | Antibody domains & multimers |
US11739144B2 (en) | 2021-03-09 | 2023-08-29 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CLDN6 |
US11859012B2 (en) | 2021-03-10 | 2024-01-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and GPC3 |
WO2022189667A1 (en) | 2021-03-12 | 2022-09-15 | Genmab A/S | Non-activating antibody variants |
WO2022206872A1 (en) | 2021-03-31 | 2022-10-06 | 江苏恒瑞医药股份有限公司 | Truncated taci polypeptide and fusion protein and use thereof |
WO2022215011A1 (en) | 2021-04-07 | 2022-10-13 | Novartis Ag | USES OF ANTI-TGFβ ANTIBODIES AND OTHER THERAPEUTIC AGENTS FOR THE TREATMENT OF PROLIFERATIVE DISEASES |
WO2022223001A1 (en) | 2021-04-22 | 2022-10-27 | 广东菲鹏制药股份有限公司 | Bispecific multifunctional fusion polypeptide |
WO2022228706A1 (en) | 2021-04-30 | 2022-11-03 | F. Hoffmann-La Roche Ag | Dosing for treatment with anti-cd20/anti-cd3 bispecific antibody |
WO2022228705A1 (en) | 2021-04-30 | 2022-11-03 | F. Hoffmann-La Roche Ag | Dosing for combination treatment with anti-cd20/anti-cd3 bispecific antibody and anti-cd79b antibody drug conjugate |
WO2022234146A1 (en) | 2021-05-07 | 2022-11-10 | Genmab A/S | PHARMACEUTICAL COMPOSITIONS COMPRISING BISPECIFIC ANTIBODIES BINDING TO B7H4 and CD3 |
WO2022237856A1 (en) | 2021-05-12 | 2022-11-17 | 江苏恒瑞医药股份有限公司 | Antigen binding molecule specifically binding to rankl and ngf, and medical use thereof |
WO2022237882A1 (en) | 2021-05-14 | 2022-11-17 | 江苏恒瑞医药股份有限公司 | Antigen-binding molecule |
WO2022243846A1 (en) | 2021-05-18 | 2022-11-24 | Novartis Ag | Combination therapies |
WO2022263501A1 (en) | 2021-06-18 | 2022-12-22 | F. Hoffmann-La Roche Ag | Bispecific anti-ccl2 antibodies |
WO2022268740A1 (en) | 2021-06-21 | 2022-12-29 | Genmab A/S | Combination dosage regime of cd137 and pd-l1 binding agents |
WO2023279092A2 (en) | 2021-07-02 | 2023-01-05 | Genentech, Inc. | Methods and compositions for treating cancer |
WO2023284829A1 (en) | 2021-07-14 | 2023-01-19 | 江苏恒瑞医药股份有限公司 | Antigen-binding molecule specifically binding to hgfr and eger, and pharmaceutical use thereof |
WO2023001884A1 (en) | 2021-07-22 | 2023-01-26 | F. Hoffmann-La Roche Ag | Heterodimeric fc domain antibodies |
WO2023006809A1 (en) | 2021-07-27 | 2023-02-02 | Morphosys Ag | Combinations of antigen binding molecules |
WO2023010095A1 (en) | 2021-07-28 | 2023-02-02 | F. Hoffmann-La Roche Ag | Methods and compositions for treating cancer |
WO2023031473A1 (en) | 2021-09-06 | 2023-03-09 | Genmab B.V. | Antibodies capable of binding to cd27, variants thereof and uses thereof |
WO2023044483A2 (en) | 2021-09-20 | 2023-03-23 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
WO2023046071A1 (en) | 2021-09-23 | 2023-03-30 | 江苏恒瑞医药股份有限公司 | Anti-klb antibodies and uses |
WO2023051798A1 (en) | 2021-09-30 | 2023-04-06 | 江苏恒瑞医药股份有限公司 | Anti-il23 antibody fusion protein and uses thereof |
WO2023057571A1 (en) | 2021-10-08 | 2023-04-13 | Genmab A/S | Antibodies binding to cd30 and cd3 |
WO2023062050A1 (en) | 2021-10-14 | 2023-04-20 | F. Hoffmann-La Roche Ag | New interleukin-7 immunoconjugates |
WO2023062048A1 (en) | 2021-10-14 | 2023-04-20 | F. Hoffmann-La Roche Ag | Alternative pd1-il7v immunoconjugates for the treatment of cancer |
WO2023092004A1 (en) | 2021-11-17 | 2023-05-25 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of tau-related disorders |
WO2023094282A1 (en) | 2021-11-25 | 2023-06-01 | F. Hoffmann-La Roche Ag | Quantification of low amounts of antibody sideproducts |
WO2023104938A1 (en) | 2021-12-10 | 2023-06-15 | F. Hoffmann-La Roche Ag | Antibodies binding to cd3 and plap |
WO2023150778A1 (en) | 2022-02-07 | 2023-08-10 | Visterra, Inc. | Anti-idiotype antibody molecules and uses thereof |
WO2023174952A1 (en) | 2022-03-15 | 2023-09-21 | Genmab A/S | Binding agents binding to epcam and/or cd137 |
WO2023174521A1 (en) | 2022-03-15 | 2023-09-21 | Genmab A/S | Binding agents binding to epcam and cd137 |
WO2023175064A1 (en) | 2022-03-17 | 2023-09-21 | Astrazeneca Ab | Methods for purifying bispecific antibodies |
WO2023180353A1 (en) | 2022-03-23 | 2023-09-28 | F. Hoffmann-La Roche Ag | Combination treatment of an anti-cd20/anti-cd3 bispecific antibody and chemotherapy |
WO2023198727A1 (en) | 2022-04-13 | 2023-10-19 | F. Hoffmann-La Roche Ag | Pharmaceutical compositions of anti-cd20/anti-cd3 bispecific antibodies and methods of use |
WO2023202967A1 (en) | 2022-04-19 | 2023-10-26 | F. Hoffmann-La Roche Ag | Improved production cells |
WO2023209568A1 (en) | 2022-04-26 | 2023-11-02 | Novartis Ag | Multispecific antibodies targeting il-13 and il-18 |
WO2023218051A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
WO2023218046A1 (en) | 2022-05-12 | 2023-11-16 | Genmab A/S | Binding agents capable of binding to cd27 in combination therapy |
WO2023220695A2 (en) | 2022-05-13 | 2023-11-16 | Voyager Therapeutics, Inc. | Compositions and methods for the treatment of her2 positive cancer |
WO2023232961A1 (en) | 2022-06-03 | 2023-12-07 | F. Hoffmann-La Roche Ag | Improved production cells |
WO2024030976A2 (en) | 2022-08-03 | 2024-02-08 | Voyager Therapeutics, Inc. | Compositions and methods for crossing the blood brain barrier |
WO2024059739A1 (en) | 2022-09-15 | 2024-03-21 | Voyager Therapeutics, Inc. | Tau binding compounds |
WO2024079009A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and proteasome inhibitors |
WO2024079015A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and imids |
WO2024079010A1 (en) | 2022-10-10 | 2024-04-18 | F. Hoffmann-La Roche Ag | Combination therapy of a gprc5d tcb and cd38 antibodies |
WO2024079069A1 (en) | 2022-10-12 | 2024-04-18 | F. Hoffmann-La Roche Ag | Method for classifying cells |
WO2024094660A1 (en) | 2022-10-31 | 2024-05-10 | Genmab A/S | Cd38 antibodies and uses thereof |
WO2024100170A1 (en) | 2022-11-11 | 2024-05-16 | F. Hoffmann-La Roche Ag | Antibodies binding to hla-a*02/foxp3 |
WO2024104988A1 (en) | 2022-11-15 | 2024-05-23 | F. Hoffmann-La Roche Ag | Recombinant binding proteins with activatable effector domain |
WO2024104933A1 (en) | 2022-11-15 | 2024-05-23 | F. Hoffmann-La Roche Ag | Antigen binding molecules |
WO2024107752A2 (en) | 2022-11-15 | 2024-05-23 | Onestone Therapeutics Llc | Compositions and methods for immunomodulatory bifunctional fusion molecules |
Also Published As
Publication number | Publication date |
---|---|
US9505848B2 (en) | 2016-11-29 |
IL194145A0 (en) | 2011-08-01 |
JP2017046720A (en) | 2017-03-09 |
US20070287170A1 (en) | 2007-12-13 |
IL194145A (en) | 2013-11-28 |
AU2007229698A1 (en) | 2007-10-04 |
PL1999154T3 (en) | 2013-03-29 |
US20190211079A1 (en) | 2019-07-11 |
SI1999154T1 (en) | 2013-01-31 |
CA2646965A1 (en) | 2007-10-04 |
JP6104121B2 (en) | 2017-03-29 |
WO2007110205A3 (en) | 2008-02-28 |
AR060070A1 (en) | 2008-05-21 |
US20150104865A1 (en) | 2015-04-16 |
JP2014023535A (en) | 2014-02-06 |
EP1999154A2 (en) | 2008-12-10 |
AU2007229698B2 (en) | 2012-10-04 |
ES2395969T3 (en) | 2013-02-18 |
PT1999154E (en) | 2013-01-24 |
JP2009531040A (en) | 2009-09-03 |
US20170145078A1 (en) | 2017-05-25 |
JP5474531B2 (en) | 2014-04-16 |
EP1999154B1 (en) | 2012-10-24 |
DK1999154T3 (en) | 2012-12-03 |
AU2007229698B9 (en) | 2012-11-08 |
US8871912B2 (en) | 2014-10-28 |
CA2646965C (en) | 2016-06-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20190211079A1 (en) | Engineered heterodimeric protein domains | |
TWI788286B (en) | Trispecific and/or trivalent binding proteins | |
US10982008B2 (en) | Domain-exchanged antibody | |
TW202212358A (en) | Dual variable region antibody-like binding proteins having cross-over binding region orientation | |
US11535674B2 (en) | Bivalent bispecific antibody hybrid protein expression and preparation methods | |
WO2017143840A1 (en) | Method for expressing and preparing polyvalent multi-specific antibody and immune hybrid protein | |
US20220227867A1 (en) | ICOS TARGETED HETERODIMERIC FUSION PROTEINS CONTAINING IL-15/IL-15RA Fc-FUSION PROTEINS AND ICOS ANTIGEN BINDING DOMAINS | |
US20240132584A1 (en) | Heterodimeric antibodies that bind cd3 and cldn6 | |
US20220144956A1 (en) | HETERODIMERIC ANTIBODIES THAT BIND TGFbetaRII | |
US20230046416A1 (en) | Chemically Induced Association and Dissociation of Therapeutic FC Compositions and Chemically Induced Dimerization of T Cell Engager with Human Serum Albumin | |
US20240059786A1 (en) | Anti-cd28 x anti-trop2 antibodies | |
CA3079793A1 (en) | Bispecific antigen binding construct | |
US20190352429A1 (en) | Preferred pairing of antibody domains | |
US20230340128A1 (en) | Anti-cd28 x anti-msln antibodies | |
Shukla et al. | Downstream Processing of fc Fusion Proteins, Bispecific Antibodies, and Antibody–Drug Conjugates | |
US20230116446A1 (en) | HETERODIMERIC Fc FOR MAKING FUSION PROTEINS AND BISPECIFIC ANTIBODIES | |
CN118119642A (en) | Engineered Fc variants | |
WO2017009419A1 (en) | Bispecific antibody-like molecules having bivalency vis-à-vis each antigen |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 07723539 Country of ref document: EP Kind code of ref document: A2 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2007723539 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 194145 Country of ref document: IL |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2646965 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2009501919 Country of ref document: JP |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2007229698 Country of ref document: AU |
|
ENP | Entry into the national phase |
Ref document number: 2007229698 Country of ref document: AU Date of ref document: 20070323 Kind code of ref document: A |