WO2007031875A2 - Modified antigen binding molecules with altered cell signaling activity - Google Patents

Modified antigen binding molecules with altered cell signaling activity Download PDF

Info

Publication number
WO2007031875A2
WO2007031875A2 PCT/IB2006/003294 IB2006003294W WO2007031875A2 WO 2007031875 A2 WO2007031875 A2 WO 2007031875A2 IB 2006003294 W IB2006003294 W IB 2006003294W WO 2007031875 A2 WO2007031875 A2 WO 2007031875A2
Authority
WO
WIPO (PCT)
Prior art keywords
antigen binding
binding molecule
modified
heavy chain
substitution
Prior art date
Application number
PCT/IB2006/003294
Other languages
French (fr)
Other versions
WO2007031875A3 (en
Inventor
Pablo Umana
Ekkehard Mossner
Original Assignee
Glycart Biotechnology Ag
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=37865318&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2007031875(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to JP2008527537A priority Critical patent/JP5373396B2/en
Priority to EP11163023.2A priority patent/EP2395023B1/en
Priority to EP11163025.7A priority patent/EP2395024B1/en
Priority to KR1020137024997A priority patent/KR101460932B1/en
Priority to CN2006800388491A priority patent/CN101291954B/en
Priority to AU2006290433A priority patent/AU2006290433B2/en
Priority to EP06831581.1A priority patent/EP1931712B1/en
Application filed by Glycart Biotechnology Ag filed Critical Glycart Biotechnology Ag
Priority to KR1020087007364A priority patent/KR101379568B1/en
Priority to CA2619298A priority patent/CA2619298C/en
Priority to BRPI0615397-6A priority patent/BRPI0615397B1/en
Priority to RU2008111068/10A priority patent/RU2482132C2/en
Priority to NO20081328A priority patent/NO345919B1/en
Priority to BR122020020335-8A priority patent/BR122020020335B1/en
Publication of WO2007031875A2 publication Critical patent/WO2007031875A2/en
Publication of WO2007031875A3 publication Critical patent/WO2007031875A3/en
Priority to IL189756A priority patent/IL189756A/en
Priority to ZA2008/02500A priority patent/ZA200802500B/en
Priority to PH12012502376A priority patent/PH12012502376B1/en
Priority to NO20210557A priority patent/NO20210557A1/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/02—Stomatological preparations, e.g. drugs for caries, aphtae, periodontitis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/06—Anti-spasmodics, e.g. drugs for colics, esophagic dyskinesia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A61P11/06—Antiasthmatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/08—Drugs for disorders of the urinary system of the prostate
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/10—Drugs for disorders of the urinary system of the bladder
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/12—Drugs for disorders of the urinary system of the kidneys
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00—Drugs for genital or sexual disorders; Contraceptives
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P5/00—Drugs for disorders of the endocrine system
    • A61P5/14—Drugs for disorders of the endocrine system of the thyroid hormones, e.g. T3, T4
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00—Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06—Antianaemics
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41—Glycosylation, sialylation, or fucosylation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/522—CH1 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567—Framework region [FR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734—Complement-dependent cytotoxicity [CDC]
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells
    • C12N2510/02—Cells for production

Definitions

  • the present invention relates to antigen binding molecules (ABMs).
  • the present invention relates to recombinant monoclonal antibodies or fragments, including chimeric, primatized or humanized antibodies or fragments, having altered ability to mediate cell signaling activity by a target antigen, and/or altered ability to mediate cross-linking of one or more target antigens.
  • the present invention relates to nucleic acid molecules encoding such ABMs, and vectors and host cells comprising such nucleic acid- molecules.
  • the invention further relates to methods for producing the ABMs of the invention, and to methods of using these ABMs in treatment of disease.
  • the present invention relates to ABMs with modified glycosylation having improved therapeutic properties, including antibodies with increased Fc receptor binding and increased effector function.
  • Antibodies also called immunoglobulins, have a basic structure comprising four polypeptide chains: two identical heavy (H) chains paired with two identical light (L) chains. Each heavy and light chain comprises a variable region (VH and VL, respectively) and a constant region (CH and CL, respectively).
  • the CH region has 3 domains (CHl, CH2, and CH3), while the smaller CL region has only one domain (simply refered to as CL).
  • Each VH and VL region comprises 3 complementarity determinhig regions (CDRs) flanked by 4 framework regions in the following order: FR1-CDR1-FR2-CDR2-FR3- CDR3-FR4.
  • the CDRs are the most variable part of the of the V region, and determine the antigen specificity of the antibody. Together, a paired VH and VL form the antigen binding site, and bivalent antibodies have two such antigen binding sites. It should be noted that this basic antibody structure can be modified in various ways (e.g., by generating fragments of the structure) while still retaining or even improving desired functions and/or antigen binding activity.
  • the interface between the VH and CHl domains comprises conserved amino acids.
  • This area of contact can be described as a "molecular ball-and- socket joint.”
  • This joint determines the "elbow motion” and also the so called “elbow angle” of the VH and VL regions with respect to the CHl and CL regions, and prevents a rigid contact from forming between the V and C regions (Lesk and diligent Chothia, ⁇ f ⁇ re (1988) 335(8): 188-190)).
  • the socket of the ball-and-socket joint is formed by amino acid residues in the VH framework region, specifically those at positions 11, 110, and 112 (according to the numbering system of Kabat et al.,
  • monoclonal antibodies can modulate cellular functions by inducing or inhibiting cell signaling pathways.
  • monoclonal antibodies have been shown to mediate antigen cross-linking, activate death receptors (e.g., by facilitating oligomerization of receptors or mimicking ligand binding), and blocking of ligand-mediated cell signaling in cell growth differentiation, and/or proliferation pathways (see, e.g., Ludwig et ah, Oncogene (2003) 22: 9097- 9106).
  • Apoptosis or programmed cell death, can be triggered by several different mechanisms. For example, the activation of signaling pathways through cell membrane-bound "death receptors," e.g., members of the tumor necrosis factor receptor (TNFR) superfamily, can lead to induction of apoptosis. Likewise, dimerization or cross-linking of surface antigen, e.g., CD20, can also induce apoptosis (see, e.g., Ludwig et al, Oncogene (2003) 22: 9097-9106).
  • TNFR tumor necrosis factor receptor
  • ABSMs modified antigen binding molecules
  • ABMs modified antigen binding molecules
  • this method involves producing recombinant, chimeric antibodies or chimeric fragments thereof.
  • the efficacy of these modified ABMs is further enhanced by engineering the glycosylation profile of the antibody Fc region.
  • the invention is directed to a modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein said substitution results in altered cell signaling activity of a target antigen when said modified antigen binding molecule is complexed with said target antigen.
  • the altered cell signaling activity is apoptosis.
  • the modified antigen binding molecule has an increased ability to induce apoptosis.
  • the modified antigen binding molecule has a reduced ability to induce apoptosis.
  • the invention is directed to a modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of aparent antigen binding molecule, wherein saidmodified antigen binding molecule has altered ability to mediate cross-linking of one or more target antigens as a result of said substitution.
  • the modified antigen binding molecule of the present invention comprises a substitution in FRl of the heavy chain variable region.
  • the substitution comprises a replacement selected from the group consisting of at least 2, at least 3, or at least 4 amino acids.
  • the substitution comprises areplacement of the entire
  • the germline VH FRl comprises an amino acid sequence at Kabat positions 8 to 13 selected from the group consisting of SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO: 65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO.73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, SEQ ID NO:101, SEQ ID NO: 102,' SEQ ID NO:103, SEQ ID NO:104, and SEQ ID NO:105.
  • the modified ABM comprises a substitution in FRl of the heavy chain variable region which comprises a replacement of an amino acid residue at one or more of Kabat positions 8, 9, 10, 11, 12, or 13.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 8.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 8 with an amino acid residue selected from the group consisting of arginine, and glycine.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 9.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 9 with an amino acid residue selected from the group consisting of alanine, proline, glycine, serine, and histidine.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 10.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 10 with an amino acid residue selected from the group consisting of glutamate, threonine, glycine, alanine, and valine.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 11.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 11 with any amino acid but leucine.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 11 with a nonpolar amino acid.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 11 with an amino acid residue selected from the group consisting of valine, leucine, isoleucine, serine, and phenylalanine.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 11 with a leucine.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 12.
  • the substitution comprises areplacement of the amino acid residue at Kabat position 12 with an amino acid residue selected from the group consisting of lysine, valine, leucine, and isoleucine.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residues at Kabat positions 11 and 12.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 11 with a valine and at Kabat position 12 with a lysine; a replacement of the amino acid residue at Kabat position 11 with a leucine and at Kabat position 12 with a valine; a replacement of the amino acid residue at Kabat position 11 with a valine and at Kabat position 12 with an isoleucine; or a replacement of the amino acid residue at Kabat position 11 with a valine and at Kabat position 12 with a valine.
  • the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 13.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 13 with an amino acid residue selected from the group consisting of lysine, arginine, glutamine and glutamate.
  • the substitution in the ABM comprises replacement of at least one amino acid residue in FR4 of the heavy chain variable region.
  • the substitution in FR4 of the heavy chain variable region comprises a replacement of an amino acid residue at one or more of Kabat positions 110 or 112.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 110 with an amino acid selected from, the group consisting of leucine, isoleucine, threonine or serine.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 110 with an isoleucine.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 112 with an amino acid selected from the group consisting of valine, leucine, isoleucine, or threonine.
  • the substitution comprises a replacement of the amino acid residue at Kabat position 112 with an isoleucine.
  • the present invention is further directed to a modified antigen binding molecule comprising a CHl domain comprising at least one amino acid residue substitution as compared to the CHl domain of a parent polypeptide, wherein the substitution results in altered cell signaling activity of a target antigen when the modified antigen binding molecule is complexed with the target antigen.
  • the present invention is further directed to a modified antigen binding molecule comprising a CHl domain comprising at least one amino acid residue substitution as compared to the CHl domain of a parent polypeptide, wherein the antigen binding molecule has altered ability to mediate cross-linking of one or more target antigens as a result of the substitution.
  • the substitution in CHl comprises a replacement of an amino acid residue at one or more of positions 148, 149 or 150.
  • the substitution comprises a replacement of the amino acid residue position 149 with a leucine.
  • the substitution comprises a replacement of the entire CHl domain.
  • the substitution comprises a replacement of an IgG CHl domain i with an IgM CHl domain.
  • the invention is directed to a modified antigen binding molecule comprising at least one amino acid substitution, wherein said substitution comprises a replacement of an amino acid residue in the light chain in the region of the interface between the variable and constant regions, wherein the substitution results in altered cell signaling activity of a target antigen binding molecule when said modified antigen binding molecule is complexed with said target antigen.
  • the invention is directed to a modified antigen binding molecule comprising at least one amino acid substitution, wherein said substitution comprises a replacement of an amino acid residue in the light chain in the region of the interface between the variable and constant regions, wherein said modified antigen binding molecule has altered ability to mediate cross- linking of one or more target antigens as a result of said substitution.
  • the substitution in the light chain variable region of the ABM comprises a replacement of an amino acid at one or more of Kabat positions 10, 12, 39, 40, 41, 80, 81, 83, 84, 103, 105, 106, and 108.
  • the substitution in the light chain variable region of the ABM comprises a replacement of an amino acid residue at one or more of Kabat positions 40, 80, 83, 105, or 106.
  • ABM comprises a replacement of an amino acid residue at one or more of Kabat positions 40, 80, 83, 105, or 106 with a non-polar amino acid.
  • ABM comprises a replacement of an amino acid residue at Kabat position 40 with an alanine.
  • ABM comprises a replacement of an amino acid residue at Kabat position 80 with a proline.
  • ABM comprises a replacement of an amino acid residue at Kabat position 83 with a phenylalanine.
  • ABM comprises a replacement of an amino acid residue at Kabat position 105 with an alanine.
  • ABM comprises a replacement of an amino acid residue at Kabat position 106 with an alanine.
  • the substitution in the light chain of the ABM comprises a replacement of an amino acid residue at Kabat position 106, wherein the antigen binding molecule is reduced in its ability to induce apoptosis.
  • substitutions of the present invention comprise a combination of any of the amino acid residue replacements in the heavy and/or light chain variable and/or constant regions as described herein.
  • the amino acid substitution(s) in the modified ABMs of the present invention result in altered cell signaling activity of a target antigen when the modified ABM is complexed with the target antigen.
  • the altered cell signaling activity is increased agonist activity.
  • the increased agonist activity is selected from the group consisting induction of apoptosis and induction of cell differentiation.
  • the altered cell signaling activity is increased antagonist activity.
  • the antagonist activity is blockade of a cell signaling pathway selected from the group consisting of cell survival, cell growth, cell proliferation, and angiogenesis.
  • the modified antigen binding molecule of the present invention binds specifically to human CD20.
  • the modified antigen binding molecule binds specifically to a member of the human TNF receptor superfamily.
  • the TNF receptor superfamily is selected from the group consisting of TNFRl, CD95, TRAILRl, TRAILR2, EDAR, and p75NGFR.
  • the modified antigen binding molecule binds specifically to a receptor tyrosine kinase.
  • the receptor tyrosine kinase is selected from the group consisting of HERl (EGFRl), HER2/neu, HER3, HER4, IGF-IR, FGFR 5 PDGFR, VEGFRl, VEGFR2, and VEGFR3.
  • the receptor tyrosine kinase is HERl (EGFRl).
  • the present invention is further directed to a modified
  • the modified ABM that can be selected from, but is not limited to, the group consisting of a whole antibody, an Fab fragment or a fusion protein thereof, an F(ab')2 fragment or a fusion protein thereof, a minibody, a diabody, a triabody, and a tetrabody.
  • the modified ABM is chimeric or fully human.
  • the chimeric modified ABM is humanized.
  • the modified ABM is multispecific.
  • the modified ABM is bispecific.
  • the parent antigen binding molecule according to the present invention comprises a heavy chain variable region selected from the group consisting of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, and SEQ ID NO:62.
  • the parent antigen binding molecule according to the present invention comprises a light chain selected from the group consisting of SEQ ID NO: 48, SEQ ID NO:130, SEQ ID NO:131, SEQ ID NO:132, SEQ ID NO: 133, and SEQ ID NO: 134.
  • the present invention is also directed to a modified
  • the Fc region of the modified ABM has been modified to have altered oligosaccharides.
  • the Fc region has been modified to have a decreased proportion of fucose residues compared to a non- modified Fc region.
  • the Fc region has an increased proportion of bisected oligosaccharides compared to a non-modified Fc region.
  • the modified oligosaccharides are bisected complex.
  • the modified oligosaccharides have an increased proportion of bisected, nonfucosylated oligosaccharides in the Fc region compared to a non-modified Fc region.
  • the Fc region has an increased proportion of GIcNAc residues to fucose residues in the modified Fc region compared to a non- modified Fc region.
  • the bisected, nonf ⁇ cosylated oligosaccharides are hybrid, hi another specific embodiment, the bisected, nonfucosylated oligosaccharides are complex.
  • the target antigen according to the present invention is a cell surface receptor selected from the group consisting of a membrane transport receptor, a G-protein-linked receptor, and an enzyme-linked receptor.
  • the membrane transport receptor is a channel-linked receptor
  • the enzyme-linked receptor is selected from the group consisting of receptor guanylyl cyclases, receptor tyrosine kinases, tyrosine-kinase associated receptors, receptor tyrosine phosphatases, and receptor serine/threonine kinases.
  • the invention is related to a pharmaceutical composition
  • a pharmaceutical composition comprising the modified ABM of the invention. It is contemplated that the pharmaceutical composition may further comprise a pharmaceutically acceptable carrier, an adjuvant or a combination thereof.
  • the present invention is also directed to a method of treating a disease treatable by altered cell signaling activity in a patient, the method comprising administering to the patient a therapeutically effective amount of a pharmaceutical composition comprising a modified ABM according to the invention and a pharmaceutically acceptable carrier.
  • the invention is directed to an isolated polynucleotide encoding a polypeptide comprising a heavy chain or light chain variable region, wherein the heavy chain or light chain variable region comprises at least one amino acid residue substitution in at least one framework region as compared to a parent heavy chain or light chain variable region, and wherein the substitution results in altered cell signaling activity of a target antigen when the polypeptide is complexed with the target antigen.
  • the invention is directed to an isolated polynucleotide encoding a polypeptide comprising a heavy chain or light chain variable region, wherein the heavy chain or light chain variable region comprises at least one amino acid residue substitution in at least one framework region as compared to a parent heavy chain or light chain variable region, and wherein the polypeptide has altered ability to mediate cross-linking of one or more target antigens as a result of the substitution.
  • a polynucleotide according to the present invention encodes a polypeptide, wherein the polypeptide comprises an antibody heavy chain or light chain
  • a polynucleotide according to the present invention encodes a polypeptide, wherein the polypeptide comprises a fusion protein.
  • the present invention is also directed to polypeptides encoded by the polynucleotides of the present invention
  • the present invention is also directed to a vector comprising a polynucleotide according to the invention, and a host cell comprising the vector.
  • the invention is further directed to a polynucleotide encoding a polypeptide comprising a heavy chain or light chain variable region which comprises at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein the polypeptide is a modified ABM according to the invention.
  • the present invention is also directed to a host cell engineered to express at least one nucleic acid encoding a polypeptide having ⁇ (l,4)-N- acetylglucosaminyltransferase III activity in an amount sufficient to modify the oligosaccharides in the Fc region of a polypeptide produced by the host cell, wherein the polypeptide is a modified ABM according to the invention.
  • the polypeptide having ⁇ (l ,4)-N-acetylglucosaminyltransferase ITI activity is a fusion polypeptide, hi a particular embodiment, the fusion polypeptide comprises the catalytic domain of ⁇ (l,4)-N- acetylglucosaminyltransf erase III. hi another embodiment the fusion polypeptide further comprises the Golgi localization domain of a heterologous Golgi resident polypeptide.
  • the Golgi localization domain can be selected from, but is not limited to, the group consisting of the localization domain of mannosidase II, the localization domain of ⁇ (l ,2)-N-acetylglucosaminyltransferase I, the localization domain of ⁇ (l,2)-N-acetylglucosaminyltransferase II, the localization domain of mannosidase I, and the localization domain of ⁇ l-6 core fucosyltransferase.
  • the modified ABM comprises a region equivalent to the Fc region of a human IgG.
  • the modified ABM produced by the host cell of the present invention exhibits increased Fc receptor binding affinity and/or increased effector function as a result of the oligosaccharide modification.
  • the increased effector function is selected from the group consisting of increased Fc-mediated cellular cytotoxicity, increased binding to NK cells, increased binding to macrophages, increased binding to polymorphonuclear cells, increased binding to monocytes, increased direct signaling inducing apoptosis, increased dendritic cell maturation, and increased T cell priming.
  • the Fc receptor is Fc ⁇ activating receptor.
  • the Fc receptor is Fc ⁇ RIIIA receptor.
  • the host cell of the present invention may be selected from the group that includes, but is not limited to, a CHO cell, an HEK293-EBNA cell, a BHK cell, a NSO cell, a SP2/0 cell, a YO myeloma cell, a P3X63 mouse myeloma cell, a PER cell, a PER.C6 cell or a hybridoma cell.
  • the present invention is directed to a method for producing a modified ABM comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent ABM, wherein the substitution results in altered cell signaling activity of a target antigen when the modified ABM is complexed with the target antigen, the method comprising: (i) culturing the host cell of the present invention under conditions permitting the expression of the polynucleotide; and (ii) recovering the modified ABM from the culture medium.
  • the invention is directed to a method for producing a modified ABM comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein the modified antigen binding molecule has altered ability to mediate cross-linking as a result of the substitution, the method comprising: (i) culturing the host cell of the present invention under conditions permitting the expression of the polynucleotide; and (ii) recovering the modified ABM from the culture medium.
  • the invention is directed to a method of altering the ability of an ABM to facilitate formation of complexes comprising the target antigen of the ABM, the method comprising: replacing at least one amino acid residue in at least one heavy chain or light chain variable region framework region of a parent ABM.
  • the ABM increases induction of apoptosis in a cell expressing the target antigen.
  • the ABM increases induction of cell differentiation in a cell expressing the target antigen.
  • the present invention is also directed to a method of inducing apoptosis in a cell, the method comprising contacting the cell with a modified ABM comprising a heavy chain or light chain variable region which comprises at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent ABM, wherein the modified ABM has increased ability to induce apoptosis compared to the parent polypeptide.
  • the cell is a tumor cell, hi one embodiment, the contacting occurs in vivo.
  • the present invention is also directed method of treating a disease or disorder that is treatable by altered cell signaling activity of a target antigen, the method comprising administering to a subject in need thereof a therapeutically effective amount of a modified ABM, wherein the modified ABM comprises a heavy chain or light chain variable region comprising at least one amino acid substitution in at least one framework region of the heavy chain or light chain variable region compared to the heavy chain or light chain variable region of a p'arent ABM, and wherein the substitution results in altered cell signaling activity of a target antigen when the modified ABM is complexed with the target antigen.
  • the invention is directed to a method of treating a disease or disorder that is treatable by altered ability to mediate cross linking of one or more target antigens, the method comprising administering to a subject in need thereof a therapeutically effective amount of a modified ABM, wherein the modified ABM comprises a heavy chain or light chain variable region comprising at least one amino acid substitution in at least one framework region of the heavy chain or light chain variable region compared to the heavy chain or light chain variable region of a parent ABM, and wherein the modified ABM has altered ability to mediate cross-linking of one or more target antigens as a result of the substitution.
  • the modified ABM administered according to the present invention comprises a heavy chain variable region selected from the group consisting of SEQ ID NO:4, SEQ E) NO:36, and SEQ ID NO.38.
  • the disease or disorder to be treated with a modified ABM of the present invention is a cell proliferation disorder, hi one embodiment, cell proliferation disorder is cancer.
  • cell proliferation disorder is cancer.
  • the disease or disorder to be treated with a modified ABM of the present invention is a B cell disorder.
  • the B cell disorder is a B cell lymphoma.
  • the present invention is also directed to use of a modified ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer.
  • the present invention is also directed to use of a modified ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer, wherein said cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
  • the present invention is also directed to use of a modified ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer, wherein said antigen binding molecule is used in a therapeutically effective amount from about 1.0 mg/kg to about 15 mg/kg.
  • the therapeutically effective amount is from about 1.5 mg/kg to about 12 mg/kg.
  • the therapeutically effective amount is from about 1.5 mg/kg to about 4.5 mg/kg.
  • the therapeutically effective amount is from about 4.5 mg/kg to about 12 mg/kg.
  • the therapeutically effective amount is about 1.5 mg/kg.
  • the therapeutically effective amount is about 4.5 mg/kg.
  • the therapeutically effective amount is about 12 mg/kg.
  • the present invention is also directed to a method for the treatment or prophylaxis of cancer comprising administering a therapeutically effective amount of a pharmaceutical composition of the invention to a patient in need thereof.
  • the cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
  • the present invention is also directed to a method for the treatment or prophylaxis of a precancerous condition or lesion comprising administering a therapeutically effective amount of the pharmaceutical composition of claim 85 or 158 to a patient in need thereof.
  • the precancerous condition or lesion is selected from the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
  • the present invention is also directed to a modified antigen binding molecule of the present invention for use in the treatment or prophylaxis of cancer.
  • the cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
  • the present invention is also directed to a modified antigen binding molecule of the present invention for use in the treatment or prophylaxis of a precancerous condition or lesion.
  • the precancerous condition or lesion is selected from the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
  • the present invention is also directed to a modified antigen binding molecule according to the present invention for use in therapy of a disorder that is related to altered cell signaling activity and/or altered cross-linking of one or more target antigens.
  • FIG. Amino acid sequence alignment of various anti-CD20 antibody heavy chain variable region constructs.
  • the amino acid sequence of the variable chain heavy region of monoclonal antibody 1F5 is used as the reference sequence. Differences in amino acids from 1F5 are shaded.
  • FIG. Binding of different humanized anti-CD20 antibodies to Raji
  • B-cells The parental (chimeric) B-IyI is compared to those two humanized heavy chain variants that were identified to induce strong apoptosis (BHH2 and BHH6), as well as those derivatives of the (humanized, nonapoptotic) B- HL8 variant that were hypothesized to restore this effect (B-HLl 1 to 17). All humanized heavy chain variants were paired with the same BKVl humanized light chain variant.
  • FIG. Binding of rituximab (O) and chB-lyl ( ⁇ ) to CD20 on Raji B- lymphoma cells.
  • FIG 4. Comparison of antibody-dependent apoptosis by three anti-CD20 antibodies.
  • chB-lyl wt represents a chimeric B-IyI antibody construct having a murine variable region and a human constant region.
  • BHH2-BKV1 represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from VHl class human germline V genes for the heavy chain and paired with the BKVl humanized B-IyI light chain.
  • BHL8-BKV1 wt represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from two different human germline V genes and paired with the BKVl humanized B-IyI light chain.
  • FIG 5. Comparison of antibody-dependent apoptosis by five humanized variants of the B-IyI anti-CD20 antibody.
  • BHH2-BKV1 represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from VHl class for the heavy chain (BHH2) and paired with the BKVl humanized B-IyI light chain.
  • BHL8-BKVlwt represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from two different human germline V genes and paired with the BKVl humanized B-IyI light chain.
  • BHL14-BKV1 represents a derivative of BHL8, with a valine to lysine substitution at Kabat position 12 and a valine to methionine substitution at Kabat position 48 of the heavy chain variable region, and paired with the BKVl light chain construct.
  • BHL15-BKV1 Wl is also derived from BHL8, with a glycine to serine substitution at Kabat position 16, and a valine to methionine substitution at Kabat position 48 of the heavy chain variable region and paired with the BKVl light chain construct.
  • BHLl 6-BKV1 Wl is derived from BHL8, with a leucine to valine substitution at Kabat position 20, and a valine to methionine substitution at Kabat position 48 of the heavy chain variable region and paired with the BKVl light chain construct.
  • BHL17-BKV1 Wl is derived from BHL8, with a valine to methionine substitution at Kabat position 48 of the heavy chain variable region and paired with the BKVl light chain construct.
  • FIG. Comparison of antibody-dependent apoptosis in Z-138 cells by
  • BHH2-BKV1 represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from VHl class human germline V genes for the heavy chain and paired with the BKVl humanized B-IyI light chain.
  • BHL13-BKV1 is derived from BHL8 (see Figure 5, above), with a leucine to valine substitution at Kabat position 11 and a valine to methionine substitution at Kabat position 48 in the heavy chain variable region, and paired with a BKVl light chain.
  • FIG 7. B-CeIl depletion by rituximab (0) and chB-lyl ( ⁇ ) in whole blood of the three different classes of Fc ⁇ RIIIa-158V/F genotype: (A) whole blood from a F/F donor, homozygous for the lower affinity receptor; (B) whole blood from a F/V donor, heterozygous for the affinity receptor; and (C) whole blood from a V/V donor, homozygous for the higher affinity receptor.
  • FIG 8. MALDI-TOF profile of a glycoengineered, chimeric B-IyI antibody.
  • A Table detailing the percentages of specific peaks;
  • B Spectrum for glycoengineered chimeric B-IyI ;
  • C Spectrum for glycoengineered chimeric B- LyI treated with Endo-H.
  • FIG 9. Binding of different humanized anti-CD20 antibodies to Raji B- cells.
  • the differences between the B-HH2 construct and the B-HL8 and B-HLl 1 constructs are located in the framework 1 and 2 regions with all three CDRs being identical.
  • B-HL8 and B-HLIl have their FRl andFR2 sequences derived from the human VH3 class, whereas the complete B-HH2 framework is human VHl derived.
  • B-HLIl is a derivative of B-HL8 with the single mutation GlulGln, with GIn being the amino acid residue in the B-HH2 construct. This means that the Glul Gm exchange does not alter binding affinity or intensity.
  • the other differences between B-HH2 and B-HL8 are 14 FR residues, from which one or more will influence the antigen binding behavior of this antibody.
  • FIG. 10 Binding of the humanized anti-CD20 antibody BHL4-BKV1 on
  • the B-HL4 construct is derived from the B-HH2 antibody by replacing the FRl of the B-HH2 with that of the human germ line sequence IGHVl -45 (Ace No X92209).
  • This construct shows greatly diminished antigen binding capacity, despite having different amino acids at only four positions within FRl .
  • residues are located at positions 2, 14, 28 and 30 according to Kabat numbering. Of these, positions 28, and 30 appear to be influential positions, since they are part of the Chothia definition of CDRl.
  • FIG. 11 Comparison of the binding behavior between B-HH 1 , B-HH2,
  • B-HH3 (all paired with the BKVl humanized B-IyI light chain), and the parental antibody B-IyI .
  • the data show that all Abs show a similar EC50 value, but the B-HHl construct binds with a lower intensity/stoichiometry than the the variants B-HH2 and B-HH3.
  • B-HHl can be distinguished from B-HH2 and B-HH3 by its partially human CDRl and CDR2 regions (Kabat definition), as well as the Ala/Thr polymorphism at position 28 (Kabat numbering). This indicates that either position 28, the complete CDRl, and/or the complete CDR2 is important for antibody/antigen interaction.
  • FIG 12. Comparison of the binding behavior between B-HLl, B-HHl, and the B-IyI parental antibody.
  • the data showed absence of any binding activity in the B-HLl construct, and about half of the binding intensity /stoichiometry of B-HHl compared to B-IyI.
  • Both B-HLl, as well as B-HHl are designed based on acceptor frameworks derived from the human VHl class.
  • position 71 (Kabat numbering) of the B-HLl construct is a striking difference, indicating its putative importance for antigen binding.
  • FIG 13 Comparison of the binding behavior between the anti-CD20 antibody heavy chain construct B-HL2, and B-HL3 to its antigen. In both cases the murine VL sequence was combined with the humanized heavy chains The data showed that the B-HL2 and B-HL3 constructs do not display CD-20 binding activity.
  • FIG 14. Apoptotic effect of anti-CD20 antibodies on Z-138 MCL cells.
  • FIG 15. Apoptosis by anti-CD20 antibodies. Assay details: 5 x 10 5 cells/well were seeded in 24- well plates (5 x 10 5 cells/ml) in culture medium. 10 ⁇ g/ml final concentration of the respective antibody, PBS for the negative control or 5mM Camptothecin (CPT) positive control were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate. (*): Signal for PBS alone subtracted (PBS alone gave 8% and 2% AnnV+ for PR-I and Z-138 cells, respectively). Antibodies used were: C2B8 (chimeric, non-glycoengineered); BHH2-BKV1 (humanized, non-glycoengineered). Note: this assay does not involve any additional effector cells, just targets plus antibody or controls.
  • Antibodies used were: C2B8 (chimeric, non-glycoengineered form); BHH2-BKVl-wt (humanized, non-glycoengineered form of BHH2-BKV1); BHH2-BKV1-GE (humanized, glycoengineered form of BHH2-BKV1).
  • FIG. MALDI/TOF-MS profile of PNGaseF-released Fc- oligosaccharides of unmodified, nonglycoengineeredBHH2-BKVl humanized IgGl B-IyI anti-human CD20 antibody.
  • FIG. MALDI/TOF-MS profile of PNGaseF-released Fc- oligosaccharides of glycoengineered BHH2-BKVlgl humanized IgGl B-IyI anti-human CD20 antibody.
  • Glycoengineering was performed by co-expression in host cells of antibody genes and a gene encoding an enzyme with ⁇ -l,4-N- acetylglucosaminyltransferase III (GnT-IH) catalytic activity.
  • FIG. MALDI/TOF-MS profile of PNGaseF-released Fc- oligosaccharides of glycoengineered BHH2-BKVlg2 humanized IgGl B-IyI anti-human CD20 antibody. Glycoengineering was performed by co-expression in host cells of antibody genes and genes encoding an enzyme with ⁇ -l,4-N- acetylglucosaminyltransferase in (GnT-III) catalytic activity and encoding an enzyme with Golgi ⁇ -mannosidase II catalytic activity.
  • FIG 20 Binding of non-glycoengineered and glycoengineered (g2 version; see Figures 17 - 19 for glycosylation profiles) antibodies to human FcgammaRIIIa receptor displayed on the surface of CHO cells expressing recombinant CD 16.
  • FIG 21 Apoptotic effect of non-Fc engineered and Fc-engineered anti-
  • CD20 antibodies on Z-138 MCL cells were assay details: 5 x 10 5 cells/well were seeded in 24-well plates (5 x 10 5 cells/ml) in culture medium. 10 ⁇ g/ml final concentration of the respective antibody, or PBS for the negative control, were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate.
  • FIG 22 Binding of different humanized anti-CD20 antibodies to Raji B- cells.
  • the humanized heavy chain construct BHH2 is compared to its derivatives BHH4 and BHH7. Also shown are variants that address the influence of Kabat positions 28 and 30 (BHH8 and BHH9).
  • FIG 23 Effect of single amino-acid exchange on apoptosis by anti-CD20 antibodies on Z-138 MCL cells.
  • Assay details 5 x 10 5 cells/well were seeded in 24-well plates (5 x 10 5 cells/ml) in culture medium. 10 ⁇ g/ml final concentration of the respective antibody, or PBS for the negative control (no Ab), were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate.
  • Antibodies used were: C2B8 (chimeric, non-glycoengineered), BHH2 (humanized, non- glycoengineered), BHH2-A (a derivative of BHH2 with a valine to leucine substitution at Kabat position 11), and BHH2-B (a derivative of BHH2 with a lysine to valine substitution at Kabat position 12), the latter three paired with a BKVl light chain. K D of antigen binding remains unchanged by substitution. Note: this assay does not involve any additional effector cells, just targets plus antibody or controls. [0096] FIG 24. Effect of single amino-acid exchange on apoptosis by previously inactive anti-CD20 antibodies on Z-138 MCL cells.
  • Antibodies used were: C2B8 (chimeric, non-glycoengineered), BHL8 (humanized, non-glycoengineered), BHLl 3 (a derivative of BHL8 with a leucine to valine substitution at Kabat position 11 and a valine to methionine substitution at Kabat position 48), and BHL14 (a derivative of BHL8 with a valine to lysine substitution at Kabat position 12 and a valine to methionine substitution at Kabat position 48), the latter three paired with a BKVl light chain. Note: this assay does not involve any additional effector cells, just targets plus antibody or controls.
  • FIG 25 Effect of single amino-acid exchange within the light chain on apoptosis by anti-CD20 antibodies on Z-138 MCL cells.
  • Assay details 5 x 10 5 cells/well were seeded in 24-well plates (5 x 10 5 cells/ml) in culture medium. 10 ⁇ g/ml final concentration of the respective antibody, PBS for the negative control (no Ab) 5 or 5mM Camptothecin (CPT) for the positive control were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate.
  • Antibodies used were: BHH2-A (a derivative of BHH2 with a valine to leucine substitution at Kabat position 11) paired with a BKVl light chain, BHH6 (a derivative of BHH2 with a methionine to isoleucine substitution at Kabat position 34) paired with a BKVl light chain, and BHH6 paired with a BKV14 light chain (a derivative of BKVl with an isoleucine to alanine substitution at Kabat position 106).
  • FIG 26 3-dimensional depiction of a molecular "ball and socket joint" at the interface between the VH and CHl domains.
  • antigen binding molecule refers in its broadest sense to a molecule that specifically binds an antigenic determinant. By “specifically binds” is meant that the binding is selective for the antigen and can be discriminated from unwanted or nonspecific interactions.
  • modified antigen binding molecule or modified ABM is intended to refer to an ABM comprising at least one amino acid residue substitution in the heavy chain variable region and/or CHl region and/or at least one amino acid residue substitution in the light chain variable region and/or CL region.
  • antibody is intended to include whole antibody molecules, including monoclonal, polyclonal and multispecific ⁇ e.g., bispecific) antibodies, as well as antibody fragments having the Fc region and retaining binding specificity, and fusion proteins that include a region equivalent to the Fc region of an immunoglobulin and that retain binding specificity. Also encompassed are antibody fragments that retain binding specificity including, but not limited to, V H fragments, V L fragments, Fab fragments, F(ab') 2 fragments, scFv fragments, Fv fragments, minibodies, diabodies, triabodies, andtetrabodies ⁇ see, e.g., Hudson and Souriau, Nature Med.
  • whole antibody refers to an immunoglobulin molecule comprising two heavy chains and two light chains, each of which comprises a variable and constant region.
  • variable region is intended to refer to the N- terminal domain of an immunoglobulin heavy or light chain.
  • a modified ABM can comprise a functional fragment of a variable region.
  • the term heavy chain variable region is intended to refer to the N-terminal domain of an immunoglobulin heavy chain.
  • the heavy chain variable region is defined by Kabat positions 1 to 113 (with possible insertions at particular residues as designated by Kabat et ah, U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest” (1983)).
  • a modified ABM can comprise a functional fragment of a heavy chain variable region.
  • heavy chain constant region is intended to refer to the C terminal domain of a immunoglobulin heavy chain.
  • heavy chain constant region comprises a CHl domain, a CH2 domain, and a CH3 domain.
  • CHl region is intended to refer to the domain of the heavy chain of an immunoglobulin that is just C-terminal to the variable region and N-terminal to the hinge region.
  • CHl is normally defined by Kabat positions 114 to 228.
  • apoptosis is intended to refer to programmed cell death, which is characterized by certain cellular events such as nuclear fragmentation and/or formation of apoptotic bodies by condensation of cytoplasm, plasma membranes and/or organelles.
  • agonist activity is intended to refer to activity of an agent (e.g., an antigen binding molecule) when it interacts with (for example, binds to) a molecule associated with a cell surface and initiates or induces a reaction.
  • an agent e.g., an antigen binding molecule
  • antagonist activity is intended to refer to activity of an agent (e.g., an antigen binding molecule) when it interacts with (for example, binds to) a molecule on a cell and prevents initiation or induction of a reaction or discontinues an ongoing reaction.
  • an agent e.g., an antigen binding molecule
  • fusion and chimeric when used in reference to polypeptides such as ABMs refer to polypeptides comprising amino acid sequences derived from two or more heterologous polypeptides, such as portions of antibodies from different species.
  • the non- antigen binding components may be derived from a wide variety of species, including primates such as chimpanzees and humans.
  • the constant region of the chimeric ABM is most preferably substantially identical to the constant region of a natural human antibody; the variable region of the chimeric antibody is most preferably derived from a non-human (i.e., donor) antigen binding molecule that specifically binds an antigen of interest.
  • the chimeric ABM may comprise the entire donor variable region; alternatively, the chimeric antibody may comprise a humanized or primatized antibody. Humanized antibodies are a particularly preferred form of fusion or chimeric antibody.
  • humanized is used to refer to an antigen binding molecule derived from a non-human antigen-binding molecule, for example, a murine antibody, that retains or substantially retains the antigen-binding properties of the parent molecule but which is less immunogenic in humans.
  • critical framework residues e.g., those that are important for retaining good antigen binding affinity or antibody functions
  • CDRs complementarity determining regions
  • CDRl, CDR2 and CDR3 in each of the heavy and light chain variable domains of an antibody, which are flanked by four framework subregions (i.e., FRl, FR2, FR3, and FR4) in each of the heavy and light chain variable domains of an antibody: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
  • primatized is used to refer to an antigen-binding molecule derived from a non-primate antigen-binding molecule, for example, a murine antibody, that retains or substantially retains the antigen- binding properties of the parent molecule but which is less immunogenic in primates.
  • CDR complementarity determining region
  • a polypeptide having "GnTIII activity” refers to polypeptides that are able to catalyze the addition of a N-acetylglucosamine (GIcNAc) residue in ⁇ -1-4 linkage to the ⁇ -linkedmannoside of the trimannosyl core of N-linked oligosaccharides.
  • GIcNAc N-acetylglucosamine
  • ⁇ (l,4)-N-acetylglucosaminyltransferase III also known as ⁇ -l,4-mannosyl- glycoprotein 4-beta-N-acetylglucosaminyl-transferase (EC 2.4.1.144)
  • NC-IUBMB Nomenclature Committee of the International Union of Biochemistry and Molecular Biology
  • the candidate polypeptide will exhibit greater activity or not more than about 25 -fold less and, preferably, not more than about tenfold less activity, and most preferably, not more than about three-fold less activity relative to the GnTIII.
  • variant refers to a polypeptide differing from a specifically recited polypeptide of the invention by amino acid insertions, deletions, and substitutions, created using, e g., recombinant DNA techniques.
  • variants of the ABMs of the present invention include chimeric, primatized or humanized antigen binding molecules wherein one or several of the amino acid residues are modified by replacement, addition and/or deletion in such manner that does not substantially affect antigen binding affinity.
  • Guidance in determining which amino acid residues may be replaced, added or deleted without abolishing activities of interest maybe found by comparing the sequence of the particular polypeptide with that of homologous peptides and minimizing the number of amino acid sequence changes made in regions of high homology (conserved regions) or by replacing amino acids with consensus sequence.
  • recombinant variants encoding these same or similar polypeptides may be synthesized or selected by making use of the "redundancy" in the genetic code.
  • Various codon substitutions such as the silent changes which produce various restriction sites, may be introduced to optimize cloning into a plasmid or viral vector or expression in a particular prokaryotic or eukaryotic system.
  • Mutations in the polynucleotide sequence may be reflected in the polypeptide or domains of other peptides added to the polypeptide to modify the properties of any part of the polypeptide, to change characteristics such as ligand- binding affinities, interchain affinities, or degradation/turnover rate.
  • amino acid residue substitution is intended to refer to replacing one or more amino acids in a reference sequence (e.g., a parent molecule, such as an antigen binding molecule).
  • amino acid residue substitution may be achieved by, for example, a point mutation in the sequence of a nucleic acid encoding a polypeptide as compared to a parent sequence.
  • substitution of an amino acid residue maybe achieved by replacing the entire framework region of the parent polypeptide with, for example, a framework region from a germline VH sequence that comprises the desired amino acid at the position to be substituted in reference to the parent.
  • Constant amino acid substitutions are those made by replacing one amino acid with another amino acid having similar structural and/or chemical properties, i.e., conservative amino acid replacements, and may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
  • nonpolar (hydrophobic) amino acids include glycine, alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; polar neutral amino acids include serine, threonine, cysteine, tyrosine, asparagine, and glutamine; positively charged (basic) amino acids include arginine, lysine, andhistidine; and negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
  • “Insertions” or “deletions” are preferably in the range of about 1 to 20 amino acids, more preferably 1 to 10 amino acids. The variation allowed may be experimentally determined by systematically making insertions, deletions, or substitutions of amino acids in a polypeptide molecule using recombinant DNA techniques and assaying the resulting recombinant variants for activity.
  • parent antigen binding molecule refers to a polypeptide having aparticular amino acid sequence encoded by a polynucleotide sequence.
  • the sequence of the parent molecule ⁇ i.e., the parent sequence) serves as a reference sequence for making amino acid residue substitutions that alter the ability of the resulting molecule (e.g., a modified antigen binding molecule) to induce or block cell signaling activity and/or cross- linking of antigen.
  • the activity of a parent molecule serves as the reference when determining whether a substitution has an effect on cell signaling activity and/or cross-linking of antigen, and, where relevant, the extent of that effect.
  • a sequence containing one or more amino acid substitutions in comparison to its parent may in turn serve as a parent sequence for further substitutions.
  • altered cell signaling activity is intended to refer to an increase or decrease in the ability of an ABM to induce or inhibit cell signaling activity of a target antigen.
  • altered cross-linking of one or more target antigens is intended to refer to an increase or decrease in the ability of an ABM to bring into closer proximity to each other, and/or into closer proximity with other membrane-associated molecules, and/or into a more favorable conformation for interaction target antigens that are capable of forming complexes (e.g., through cross-linking of proteins, or oligomerization of membrane-associated receptors) to initiate cell signaling pathways.
  • cell signaling mechanism or cell signaling activity is intended to refer to the entire signaling (i.e., signal transduction) pathway that leads to a particular cellular event or biological function, as well as any signaling steps along the pathway.
  • nucleic acid or polynucleotide having a nucleotide sequence at least, for example, 95% "identical" to a reference nucleotide sequence of the present invention it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence.
  • nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
  • nucleic acid molecule or polypeptide is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence or polypeptide sequence of the present invention can be determined conventionally using known computer programs.
  • a preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brutlag et al, Comp. App. Biosci. ⁇ 5:237-245 (1990). In a sequence alignment the query and subject sequences are both DNA sequences.
  • RNA sequence can be compared by converting U's to T's.
  • the result of said global sequence alignment is in percent identity.
  • This corrected score is what is used for the purposes of the present invention. Only bases outside the 5' and 3' bases of the subject sequence, as displayed by the FASTDB alignment, which are not matched/aligned with the query sequence, are calculated for the purposes of manually adjusting the percent identity score.
  • a 90 base subject sequence is aligned to a 100 base query sequence to determine percent identity.
  • the deletions occur at the 5' end of the subject sequence and therefore, the FASTDB alignment does not show a matched/alignment of the first 10 bases at 5' end.
  • the 10 unpaired bases represent 10% of the sequence (number of bases at the 5' and 3' ends not matched/total number of bases in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 bases were perfectly matched the final percent identity would be 90%.
  • a 90 base subject sequence is compared with a 100 base query sequence.
  • deletions are internal deletions so that there are no bases on the 5' or 3' end of the subject sequence which are not matched/aligned with the query.
  • percent identity calculated by FASTDB is not manually corrected.
  • bases on the 5' and 3 1 end of the subject sequence which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are to made for the purposes of the present invention.
  • polypeptide having an amino acid sequence at least, for example,
  • amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
  • up to 5% of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid.
  • alterations of the reference sequence may occur at the amino or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
  • 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference polypeptide can be determined conventionally using known computer programs.
  • a preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence can be determined using the FASTDB computer program based on the algorithm of Brutlag ⁇ t al, Comp. App. Biosci. (5:237-245 (1990).
  • the query and subject sequences are either both nucleotide sequences or both amino acid sequences.
  • the result of said global sequence alignment is in percent identity.
  • This percentage is then subtracted from the percent identity, calculated by the above FASTDB program using the specified parameters, to arrive at a final percent identity score.
  • This final percent identity score is what is used for the purposes of the present invention. Only residues to the N— and C-termini of the subject sequence, which are not matched/aligned with the query sequence, are considered for the purposes of manually adjusting the percent identity score. That is, only query residue positions outside the farthest N- and C-terminal residues of the subject sequence.
  • a 90 amino acid residue subject sequence is aligned with a
  • deletion occurs at the N-terminus of the subject sequence and therefore, the FASTDB alignment does not show a matching/alignment of the first 10 residues at the N-terminus.
  • the 10 unpaired residues represent 10% of the sequence (number of residues at the N- and C- termini not matched/total number of residues in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 residues were perfectly matched the final percent identity would be 90%.
  • a 90 residue subject sequence is compared with a 100 residue query sequence. This time the deletions are internal deletions so there are no residues at the N- or C-termini of the subject sequence which are not matched/aligned with the query.
  • a nucleic acid that "hybridizes under stringent conditions" to a nucleic acid sequence of the invention refers to a polynucleotide that hybridizes in an overnight incubation at 42° C in a solution comprising 50% formamide, 5x SSC (750 mM NaCl, 75 mM sodium citrate), 50 mM sodium phosphate (pH 7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 ⁇ g/ml denatured, sheared salmon sperm DNA, followed by washing the filters in O.lx SSC at about 65°C.
  • Fc region is intended to refer to a C-terminal region of an IgG heavy chain.
  • the boundaries of the Ec region of an IgG heavy chain might vary slightly, the human IgG heavy chain Fc region is usually defined to stretch from the amino acid residue at position Cys226 to the carboxyl-terminus .
  • region equivalent to the Fc region of an immunoglobulin is intended to include naturally occurring allelic variants of the Fc region of an immunoglobulin as well as variants having alterations which produce substitutions, additions, or deletions but which do not decrease substantially the ability of the immunoglobulin to mediate effector functions (such as antibody dependent cellular cytotoxicity).
  • one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function.
  • variants can be selected according to general rules known in the art so as to have minimal effect on activity. ⁇ See, e.g., Bowie, J. U.
  • a region equivalent to the Fc region can also form part of a heterologous fusion protein.
  • a region equivalent to the Fc region also encompasses a corresponding region from another class of immunoglobulin heavy chain ⁇ e.g., IgA, IgE, IgD, and IgM).
  • Golgi localization domain refers to the amino acid sequence of a Golgi resident polypeptide which is responsible for anchoring the polypeptide in location within the Golgi complex.
  • localization domains comprise amino terminal "tails" of an enzyme.
  • effector function refers to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody.
  • antibody effector functions include, but are not limited to, Fc receptor binding affinity, antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune-complex-mediated antigen uptake by antigen-presenting cells, down-regulation of cell surface receptors, etc.
  • Glycosylation engineering includes metabolic engineering of the glycosylation machinery of a cell, including genetic manipulations of the oligosaccharide synthesis pathways to achieve altered glycosylation of glycoproteins expressed in cells.
  • the glycosylation engineering is an alteration in glycosyltransferase activity.
  • the engineering results in altered glucosaminyltransferase activity and/or fucosyltransferase activity.
  • host cell covers any kind of cellular system which can be engineered to generate the polypeptides and antigen-binding molecules of the present invention.
  • Host cells include cultured cells, e.g., mammalian cultured cells, such as CHO cells, BHK cells, HEK293 -EBNA cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue.
  • mammalian cultured cells such as CHO cells, BHK cells, HEK293 -EBNA cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells
  • the host cell is engineered to allow the production of an antigen binding molecule with modified glycoforms.
  • the antigen binding molecule is an antibody, antibody fragment, or fusion protein.
  • the host cells have been further manipulated to express increased levels of one or more polypeptides having GnTIII activity.
  • the host cells have been engineered to have eliminated, reduced or inhibited core ⁇ l,6- fucosyltransferase activity.
  • core al ,6-fucosyltransferase activity encompasses both expression of the core ⁇ l ,6-fucosyltransferase gene as well as interaction of the core ⁇ l ,6-fucosyltransferase enzyme with its substrate.
  • Fc-mediated cellular cytotoxicity includes antibody-dependent cellular cytotoxicity and cellular cytotoxicity mediated by a soluble Fc-fusion protein containing a human Fc-region. It is an immune mechanism leading to the lysis of "antibody-targeted cells” by "human immune effector cells”, wherein:
  • the human immune effector cells are a population of leukocytes that display Fc receptors on their surface through which they bind to the Fc-region of antibodies or of Fc-fusion proteins and perform effector functions.
  • Such a population may include, but is not limited to, peripheral blood mononuclear cells (PBMC) and/or natural killer (NK) cells.
  • PBMC peripheral blood mononuclear cells
  • NK natural killer
  • the antibody-targeted cells are cells bound by the antibodies or Fc-fusion proteins.
  • the antibodies or Fc fusion-proteins bind to target cells via the protein part N-terminal to the Fc region.
  • the term increased Fc-mediated cellular cytotoxicity is defined as either an increase in the number of "antibody-targeted cells” that are lysed in a given time, at a given concentration of antibody, or of Fc-fusion protein, in the medium surrounding the target cells, by the mechanism of Fc- mediated cellular cytotoxicity defined above, and/or a reduction in the concentration of antibody, or of Fc-fusion protein, in the medium surrounding the target cells, required to achieve the lysis of a given number of "antibody-targeted cells", in a given time, by the mechanism of Fc -mediated cellular cytotoxicity.
  • Fc-mediated cellular cytotoxicity is relative to the cellular cytotoxicity mediated by the same antibody, or Fc-fusion protein, produced by the same type of host cells, using the same standard production, purification, formulation and storage methods, which are known to those skilled in the art, but that has not been produced by host cells engineered to express the glycosyltransferase GnTIII by the methods described herein.
  • ADCC is meant an antibody, as that term is defined herein, having increased ADCC as determined by any suitable method known to those of ordinary skill in the art.
  • One accepted ADCC assay is described in the Examples set forth herein below.
  • Another accepted in vitro ADCC assay is as follows:
  • the assay uses target cells that are known to express the target antigen recognized by the antigen-binding region of the antibody;
  • PBMCs peripheral blood mononuclear cells
  • the assay is carried out according to following protocol: i) the PBMCs are isolated using standard density centrifugation procedures and are suspended at 5 x 10 6 cells/ml in PvPMI cell culture medium; ii) the target cells are grown by standard tissue culture methods, harvested from the exponential growth phase with a viability higher than 90%, washed in RPMI cell culture medium, labeled with 100 micro-Curies Of 51 Cr, washed twice with cell culture medium, and resuspended in cell culture medium at a density of 10 5 cells/ml; iii) 100 microliters of the final target cell suspension above are transferred to each well of a 96-well microtiter plate; iv) the antibody is serially-diluted from 4000 ng/ml to 0.04 ng/ml in cell culture medium and 50 microliters of the resulting antibody solutions are added to the target cells in the 96-well microtiter plate, testing in triplicate various antibody concentrations covering the whole concentration range above; v) for the maximum release
  • "increased ADCC” is defined as either an increase in the maximum percentage of specific lysis observed within the antibody concentration range tested above, and/or a reduction in the concentration of antibody required to achieve one half of the maximum percentage of specific lysis observed within the antibody concentration range tested above.
  • the increase in ADCC is relative to the ADCC, measured with the above assay, mediated by the same antibody, produced by the same type of host cells, using the same standard production, purification, formulation and storage methods, which are known to those skilled in the art, but that has not been produced by host cells engineered to overexpress GnTIII.
  • the present invention is directed to ABMs comprising modfied heavy chain and/or light chain V regions and/or C regions, and to the discovery that the ability of these ABMs to induce cell signaling activity of a target antigen and/or mediate cross-linking of target antigen can be enhanced (i.e., induced or increased) or reduced (i.e., inhibited or decreased) by such modifications.
  • the present invention provides polypeptides, including ABMs, having modified heavy chain and/or light chain V regions and/or C regions, nucleic acid sequences (e.g. vectors) encoding such polypeptides, methods for generating polypeptides having modified heavy chain and/or light chain V regions and/or C regions, and methods for using same in the treatment of various diseases and disorders.
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • induction of growth arrest or apoptosis and the blocking or inhibition of cell growth, cell proliferation, cell survival and/or other cellular events.
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • induction of growth arrest or apoptosis and the blocking or inhibition of cell growth, cell proliferation, cell survival and/or other cellular events.
  • instances of induction of cell death and other cell signaling events by agonistic monoclonal antibodies have been reported.
  • Cerisano et al showed the induction of caspase- independent cell death characterized by apoptosis-like features (including phosphatidyl-serine (PS) exposure, morphological changes and/or propidium- iodide (PI) uptake), as well as homotypic aggregation of Ewing's sarcoma cells, by stimulation with agonistic antibodies against the transmembrane glycoprotein, CD99 (e.g., anti-CD99013 MAb and 0662 MAb) (Cerisano et al, Oncogene 23: 5664-5674 (2003)).
  • PS phosphatidyl-serine
  • PI propidium- iodide
  • Hahn et al reported activation of MAPK signaling pathways by engagement of CD99 with anti-CD99 monoclonal antibodies (e.g., DNl 6 and YG32), which led to homotypic aggregation of cells (Hahn et al, FEBS Letters 470: 350-354 (2000)).
  • Pettersen et al. identified a new functional domain of CD99 that could be activated by the anti-CD99 monoclonal antibody, Ad20, which activation induced apoptosis in transformed T cells (Pettersen et al, J. Immunol. 166:4931-4942 (2001)).
  • Monoclonal antibodies against CD47 can also induce caspase-independent cell death, which is associated with cytoskeletal reorganization signaling pathways (Mateo et al, Blood 100:2882- 2890 (2002)).
  • CD47 e.g., B6H12
  • caspase-independent cell death e.g., cytoskeletal reorganization signaling pathways
  • CD20 e.g., rituximab and tositumomab
  • CD52 CAMPATH-IH
  • rituximab and tositumomab CD52
  • CD52 CAMPATH-IH
  • rituximab and several other monoclonal antibodies with little or no signaling activity anti-CD 19, CD21, CD22 and Her2
  • ability to induce apoptosis or growth arrest was enhanced by chemically converting the antibodies into IgG- IgGhomodimers.
  • the present inventors have determined that modifications to the amino acid residues in the elbow hinge region of an antigen binding molecule can affect the ability of the ABM to induce or inhibit signaling activity and/or cross-linking of target antigen.
  • the angle of the elbow hinge region controls the orientation of the V region with respect to the C region of an immunoglobulin, and as such, facilitates the interactions of antibodies with antigen and effector proteins. See Lesk and Chothia, Nature 335: 188-90 (1988).
  • the ability to change the orientation of the antigen binding sites allows for the adjustment of the proximity of bound antigen units when it is complexed with the multiple antigen binding sites.
  • the proximity of the antigen units to each other facilitates greater or lesser interaction (e.g., cross-linking, dimerization, etc.) between the antigen units. For example, if the elbow angle of each VH/VL-CHl/CL pair in an ABM is oriented such that the antigen binding sites are brought into closer proximity to each other, the bound antigen units (e.g, cell surface receptor molecules) will also be brought into closer proximity to each other or brought into a conformation that is more favorable for interaction.
  • the bound antigen units e.g, cell surface receptor molecules
  • This proximity or conformational change can mediate interactions, for example, cross4inking and oligomerization, between the bound antigens.
  • orientation of the antigen binding sites so that they are farther apart or have a less favorable conformation can prevent them from interacting.
  • Amino acid residues at the VL-CL interface can also be modified to affect the antigen binding site orientation.
  • Kabat residues 40, 80, 83, 105, and 106 in the light chain variable region frameworks are situated at the VL/CL interface.
  • any cell signaling mechanisms can be affected (i.e. induced or inhibited) by the ABMs of the present invention.
  • the cell signaling mechanisms involved are those initiated through cell surface receptor proteins including ion-channel linked, G-protein-linked, and enzyme-linked cell-surface receptor proteins. See generally, Chapter 15: Cell Signaling in MOLECULAR BIOLOGY OF THE CELL, Alberts et ah, eds., (3d ed. 1994) (incorporated herein by reference).
  • the cell signaling activities of the present invention include, but are not limited to, those which result in apoptosis, cell differentiation, cell growth, cell proliferation, and cell survival, as well as any of the signaling steps along the pathway.
  • the cell signaling activity occurs through an enzyme-linked receptor; in a particular embodiment, the enzyme-linked receptor is a receptor tyrosine kinase. In another embodiment, the cell signaling activity is through an ion channel-linked receptor.
  • ABMs of the present invention differ from the corresponding nonmodified parent polypeptide (e.g., a parent antigen binding molecule) regions by at least one amino acid substitution.
  • the "parent,” “starting,” or “nonmodified” polypeptide preferably comprises at least a portion of an antibody heavy chain or light chain, and may be prepared using techniques available in the art for generating polypeptides comprising a heavy chain V region or CHl region or portion thereof and/or a light chain V or C region or portion thereof, hi specific embodiments, the parent polypeptide is an antigen binding molecule and comprises at least a portion of a VH or VL region.
  • a modified heavy chain and/or light chain V region may be generated (e.g.
  • a modified ABM or fragment thereof comprises a fusion protein, wherein a modified heavy chainV region or fragment thereof is fused to a heavy chain constant region selected from the group consisting of IgA, IgG, IgE, IgD, and IgM, or a fragment or derivative thereof.
  • the heavy chain constant region is IgG.
  • a modified ABM or fragment thereof comprises a fusion protein, wherein a modified light chain V region or fragment thereof is fused to a light chain constant region selected from the group consisting of IgA, IgG, IgE, IgD, and IgM, or a fragment or derivative thereof.
  • the light chain constant region is IgG.
  • the polypeptides of the invention comprise a whole antibody (e.g., IgG) comprising light chains and heavy chains having a modified heavy chain and/or light chain V region.
  • Polynucleotides encoding a polypeptide comprising a modified heavy chain V region or CHl region or light chain V region or CL region may be prepared by methods known in the art using the guidance of the present specification for particular sequences. These methods include, but are not limited to, preparation by site-directed (or oligonucleotide-mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared nucleic acid encoding the polypeptide. Site-directed mutagenesis is a preferred method for preparing substitution variants. This technique is well known in the art (see e.g., Carter et a Nucleic Acids Res. 13: 4431-4443 (1985) and Kunkel et.
  • the starting DNA is altered by first hybridizing an oligonucleotide encoding the desired mutation to a single strand of such starting DNA. After hybridization, a DNA polymerase is used to synthesize an entire second strand, using the hybridized oligonucleotide as a primer, and using the single strand of the starting DNA as a template. Thus, the oligonucleotide encoding the desired mutation is incorporated in the resulting double-stranded DNA.
  • PCR mutagenesis is also suitable for making amino acid sequence variants of the nonmodified starting polypeptide (see, e.g., Vallette et. al, Nuc. Acids Res. 17: 723-733 (1989),herebyincorporatedbyreference).
  • primers that differ slightly in sequence from the corresponding region in a template DNA can be used to generate relatively large quantities of a specific DNA fragment that differs from the template sequence only at the positions where the primers differ from the template.
  • the starting material is the plasmid (or other vector) comprising the starting polypeptide DNA to be modified.
  • the codon(s) in the starting DNA to be mutated are identified.
  • the plasmid DNA is cut at these sites to linearize it.
  • a double-stranded oligonucleotide encoding the sequence of the DNA between the restriction sites but containing the desired mutation(s) is synthesized using standard procedures, wherein the two strands of the oligonucleotide are synthesized separately and then hybridized together using standard techniques.
  • This double-stranded oligonucleotide is referred to as the cassette.
  • This cassette is designed to have 5' and 3' ends that are compatible with the ends of the linearized plasmid, such that it can be directly ligated to the plasmid.
  • This plasmid now contains the mutated DNA sequence.
  • the desired amino acid sequence encoding a polypeptide variant can be determined, and a nucleic acid sequence encoding such an amino acid sequence variant can be generated synthetically.
  • the amino acid sequence of the parent polypeptide may be modified to generate an ABM having a modified heavy chain V region and/or modified CHl region, and/or a modified light chain V region and/or modified CL region, with altered ability to induce cell signaling activity of a target antigen when the modified ABM is complexed with (e.g., bound to) the target antigen.
  • the cell signaling activity can be agonist activity or antagonist activity.
  • agonist activity is induced by a modified antigen binding molecule when it binds to a cell membrane-associated receptor and initiates a cell signaling pathway.
  • the cell signaling pathway is an apoptosis pathway.
  • the cell signaling pathway is a cell differentiation pathway.
  • antagonist activity by a modified antigen binding molecule occurs, for example, when the ABM binds to a cell membrane-associated receptor and prevents the induction of a cell signaling pathway or disrupts an ongoing signal.
  • Antagonist activity may be achieved, for example, by blocking the binding and subsequent signal transduction of an endogenous ligand and/or by preventing the cross-linking or oligomerization of receptors or other molecules that would be necessary for induction of a cell signaling pathway.
  • the cell signaling pathway that is inhibited or disrupted is a cell growth pathway.
  • the cell signaling pathway that is inhibited or disrupted is a cell division pathway.
  • the cell signaling pathway that is 1 inhibited or disrupted is a cell survival pathway.
  • the amino acid sequence of the parent polypeptide may also be modified to generate an ABM having a modified heavy chain V region or modified C region (e.g., a modified CHl region), and/or amodified light chain V region and/or modified CL region, with altered ability to mediate cross-linking of one or more target antigens when the modified ABM is complexed with (e;g., bound to) the target antigen(s).
  • the bound target antigens e.g, cell surface receptor molecules
  • the bound target antigens are brought into closer proximity to each other and/or a more favorable conformation for interaction than they would be by the corresponding non-modified parent ABM, thereby increasing cross-linking and oligomerization between the bound antigens.
  • the bound target antigens e.g, cell surface receptor molecules
  • the bound target antigens are kept farther apart from each other, and/or in a less favorable conformation for interaction than they would be by the corresponding non-modified parent ABM, thereby reducing or preventing cross-linking and oligomerization between the bound antigens.
  • the increased cross-linking or oligomerization results in increased apoptosis.
  • the increased cross-linking or oligomerization results in increased cell differentiation.
  • the reduction in cross-linking or oligomerization results in decreased cell growth, decreased cell division, or decreased cell survival.
  • Substantial modifications in the biological properties of the heavy chain V region or CHl region, or light chain V region or CL region maybe accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
  • Naturally occurring residues are divided into classes based on common side-chain properties:
  • hydrophobic met, ala, val, leu, ile
  • Non-conservative substitutions will entail exchanging a member of one of these classes for a member of another class.
  • Conservative substitutions will entail exchanging a member of one of these classes for another member of the same class.
  • the present invention is related to antigen binding molecues with amino acid modifications that alter the ability of the ABMs to induce cell signaling activity and/or to mediate cross-linking of antigens.
  • the modification to the ABM comprises at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to a parent molecule.
  • the substitution replaces an amino acid residue in heavy chain FRl .
  • the modification to the ABM comprises a substitution of an amino acid residue at one or more of Kabat positions 8, 9, 10, 11, 12, or 13 in the heavy chain variable region.
  • the i modification to the ABM comprises a substitution of an amino acid residue in heavy chain FR4.
  • the modification to the ABM comprises a substitution of an amino acid residue at one or more of Kabat positions 110 or 112 in the heavy chain variable region. In another embodiment, the modification to the ABM comprises at least one amino acid residue substitution in the light chain at the interface between the V and C regions. In a more particular embodiment, the modification to the ABM comprises a substitution of an amino acid residue at one or more of Kabat positions 40, 80, 83, 105, or 106.
  • an amino acid may be substituted by generating a point mutation in the parent sequence that results in the desired change in the amino acid residue(s).
  • the modification to the ABM may comprise replacing an entire framework region of a parent molecule with a framework region that comprises a desired amino acid residue at a particular position.
  • the modification to the ABM comprises replacing the FRl of a parent molecule with the FRl encoded by a germline variable gene, sequence.
  • the ABM comprises at least a
  • CHl region and modification of the ABM comprises at least one amino acid residue substitution as compared to a parent polypeptide.
  • the modification to the ABM comprises substitution of one or more of the amino acid residues at positions 148, 149 and/or 150 in the heavy chain constant region.
  • the invention is directed to modified antigen binding molecules comprising one or more truncated CDRs of a parent antigen binding molecule.
  • Such truncated CDRs will contain, at a minimum, the specificity- determining amino acid residues for the given CDR.
  • specificity-deterrnining residue is meant those residues that are directly involved in the interaction with the antigen. In general, only about one-fifth to one-third of the residues in a given CDR participate in binding to antigen.
  • the specificity-determining residues in a particular CDR can be identified by, for example, computation of interatomic contacts from three-dimensional modeling and determination of the sequence variability at a given residue position in accordance with the methods described in Padlan et al, FASEB J. P(7J:133-139 (1995), the contents of which are hereby incorporated by reference in their entirety.
  • the invention is also directed to an isolated polynucleotide comprising at least one complementarity determining region of a parent molecule, or a variant or truncated form thereof containing at least the specificity- determining residues for said complementarity determining region, wherein said isolated polynucleotide encodes a fusion polypeptide.
  • such isolated polynucleotides encode a fusion polypeptide that is a modified antigen binding molecule.
  • the polynucleotide comprises three complementarity determining regions of parent molecule, or variants or truncated forms thereof containing at least the specificity-determining residues for each of said three complementarity determining regions.
  • polynucleotide encodes the entire variable region of the light or heavy chain of a chimeric (e.g., humanized) antibody.
  • the invention is further directed to the polypeptides encoded by such polynucleotides.
  • the invention is directed to a modified antigen binding molecule comprising at least one complementarity determining region of a parent molecule, or a variant or truncated form thereof containing at lest the specificity-determining residues for said complementarity determining region, and comprising a sequence derived from a heterologous polypeptide.
  • the modified antigen binding molecule comprises three complementarity determining regions of the parent moleclue, or variants or truncated forms thereof containing at least the specificity-determining residues for each of said three complementarity determining regions.
  • the modified antigen binding molecule comprises the variable region of an antibody light or heavy chain.
  • the antigen binding molecule is a chimeric, e.g., humanized, antibody.
  • the invention is also directed to methods of making such modified antigen binding molecules, and the use of same in the treatment of disease, including cell proliferation disorders.
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • the present invention is directed to modified ABMs that have increased ability to induce apoptosis compared to the corresponding non-modified parent ABM.
  • a parent ABM that has little or no ability to induce apoptosis may be modified according to the present invention to generate a modified ABM that does have the ability to induce apoptosis or that has an increased ability to induce apoptosis.
  • the present invention is also directed to modified ABMs that have increased ability to induce growth arrest or cell differentiation as compared to the corresponding non-modified parent ABM.
  • a parent ABM that has little or no ability to induce growth arrest or cell differentiation may be modified according to the present invention to generate a modified ABM that does have the ability to induce growth arrest or differentiation or that has an increased ability to induce growth arrest or differentiation.
  • anti ⁇ CD20 monoclonal antibodies fall into two distinct categories based on their mechanism of action in eradicating lymphoma cells.
  • Type I anti-CD20 antibodies primarily utilize complement to kill target cells, while Type II antibodies operate by different mechanisms, primarily apoptosis.
  • Rituximab and 1F5 are examples of Type I anti ⁇ CD20 antibodies, whereas Bl is an example of a Type II antibody. See, e.g., Cragg, M.S. and Glennie, M.J., Blood 103(7):2738-2743 (April 2004); Teeling, J.L. et al., Blood 104(6): 1793- 1800 (September 2004), the entire contents of which are hereby incorporated by reference.
  • U.S. Pat. Appl. Pub. No. 2005/0123546 to Umafia et al. discloses the first known instance in which a Type I anti-CD20 antibody was engineered to have increased effector functions such as ADCC, and to generate potent apoptosis ability, effectively changing a Type I anti-CD20 antibody into a Type II anti-CD20 antibody, m one embodiment, the present invention is directed to a modified anti-CD20 antibody comprising a substitution in a heavy chain or light chain variable region compared to a Type I parent anti-CD20 antibody, wherein the substitutions) result in increased induction of apoptosis by the modified anti-CD20 antibody.
  • the present invention is directed to engineered Type II anti-CD20 antibodies having increased ADCC as a result of engineering for increased effector function and without loss of substantial ability to induces apoptosis.
  • the Type II anti-CD20 antibodies comprise a substitution in one or more amino acids in the heavy chain or light chain variable region compared to a parent molecule.
  • the Type I and/or Type ⁇ anti-CD20 antibodies have been engineered to have an altered pattern of glycosylation in the Fc region.
  • the altered glycosylation of the modified ABM comprises an increased level of bisected complex residues in the Fc region.
  • the altered glycosylation of the modified ABM comprises a reduced level of fucose residues in the Fc region. See U.S. Pat. Appl. Pub. No.20040093621 to Shitara etal, the entire contents of which is incorporated by reference.
  • the Type I or Type II anti-CD20 antibodies have undergone polypeptide engineering as taught inU.S. Pat. No.6,737,056 to Presta or U.S. Pat. Appl. Pub. No. 2004 0185045 (Macrogenics) or U.S. Pat. Appl. Pub. No. 2004 0132101 (Xencor), the entire contents of each of which are incorporated by reference.
  • the invention is further directed to methods of making such engineered Type I or Type II antibodies and to methods of using such antibodies in the treatment of various B cell disorders, including B cell lymphomas.
  • the light and heavy chains can be expressed separately, using, for example, immunoglobulin light chain and immunoglobulin heavy chains in separate plasmids, or on a single (e.g., polycistronic) vector. These can then be purified and assembled in vitro into complete antibodies; methodologies for accomplishing such assembly have been described. See, for example, Scharff, M., Harvey Lectures 69:125 (1974). In vitro reaction parameters for the formation of IgG antibodies from reduced isolated light and heavy chains have also been described. See, for example, Sears et al, Biochem. 16(9):2016-25 (1977).
  • the chimeric ABM of the present invention is a humanized antibody.
  • Methods for humanizing non-human antibodies are known in the art.
  • humanized ABMs of the present invention can be prepared according to the methods of U.S. Pat. No.5,225,539 to Winter, U.S. Pat. No. 6,180,370 to Queen et al, or U.S. Pat. No. 6,632,927 to Adair et al, U.S. Pat. Appl. Publ. No. 2003/0039649 to Foote; U.S. Pat. Appl. Publ. No. 2004/0044187 to Sato et al; or U.S. Pat. Appl. Publ.
  • a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain.
  • Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321 :522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al, Science, 239: 1534-1536 (1988)), by substituting hypervariable region sequences for the corresponding sequences of a human antibody.
  • such "humanized" antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
  • the subject humanized anti- CD20 antibodies will comprise constant regions of human immunoglobulin.
  • variable domains both light and heavy
  • FR human framework region
  • Another method of selecting the human framework sequence is to compare the sequence of each individual subregion of the full rodent framework (i.e., FRl , FR2, FR3, and FR4) or some combination of the individual subregions (e.g., FRl and FR2) against a library of known human variable region sequences that correspond to that framework subregion (e.g., as determined by Kabat numbering), and choose the human sequence for each subregion or combination that is the closest to that of the rodent (Leung U.S. Patent Application Publication No. 2003/0040606A1, published Feb. 27, 2003).
  • Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
  • humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences.
  • Three-dimensional immunoglobulin models can be generated using computer programs familiar to those skilled in the art (e.g. Insight ⁇ , accelrys inc (former MSI), or at http://swissmodel.expasy.org/ described by Schwede et al., Nucleic Acids Res. 2003 (13):3381-3385).
  • FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as maintained affinity for the target antigen(s), is achieved.
  • the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
  • the antigen binding molecules of the present invention are engineered to have enhanced binding affinity according to, for example, the methods disclosed in U.S. Pat. Appl. Pub. No. 2004/0132066 to Balint et al., the entire contents of which are hereby incorporated by reference.
  • the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide having an amino acid sequence as shown in Tables 3 and/or 5, below.
  • the invention is further directed to an isolated nucleic acid comprising a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence shown in Tables 2 and/or 4, below.
  • the invention is directed to an isolated nucleic acid comprising a sequence that encodes a polypeptide having an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence in Tables 3 and/or 5, below.
  • the invention also encompasses an isolated nucleic acid comprising a sequence that encodes a polypeptide having the amino acid sequence of any of the constructs in Tables 3 and/or 5, with conservative amino acid substitutions.
  • any of the polynucleotides or polypeptides of Tables 2- 5 maybe excluded. Therefore, for example, in certain embodiments, the modified ABM, and/or the polynucleotide encoding the modified ABM, does not comprise any or all of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, or SEQ ID NO:38.
  • the modified ABM of the present invention does not comprise any or all of SEQ ID NOs:55-62.
  • the present invention is directed to an isolated polypeptide comprising an amino acid sequence as shown in Tables 3 and/or 5, below.
  • the invention is further directed to an isolated polypeptide comprising a sequence encoded by a nucleotide sequence shown in Tables 2 and/or 4, below.
  • the invention is directed to an isolated polypeptide comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence in Tables 3 and/or 5, below.
  • the invention also encompasses an isolated polypeptide comprising an amino acid sequence of any of the constructs in Tables 3 and/or 5, with conservative amino acid substitutions, hi certain embodiments, any of the polynucleotides or polypeptides of Tables 2- 5 maybe excluded. Therefore, for example, in certain embodiments, the polypeptide does not comprise an amino acid sequence corresponding to or encoded by any or all of SEQ ID NO:3, SEQ ID NO.4, SEQ ID NO:35, SEQ ID NO.36, SEQ ID NO:37, or SEQ ID NO:38. In another example, in certain embodiments, the modified ABM of the present invention does not comprise any or all of SEQ ID NOs:55-62.
  • the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide having an amino acid sequence derived from a parent sequence shown in FIG. 1 and Table 6, and comprising at least one amino acid substitution in at least one heavy chain FR region.
  • the present invention is directed to an isolated polypeptide comprising an amino acid sequence derived from a parent sequence shown in FIG. 1 and Table 6, and comprising at least one amino acid substitution in at least one heavy chain FR region.
  • the modified ABMs of the present invention can comprise a substitution of an entire framework region compared to aparent ABM.
  • the present invention is further directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide having at least one heavy chain FR derived from a human germline VH sequence, hi a preferred embodiment, the human VH germline sequence in the FRl region, or in the Kabat positions 8- 13 is derived from any one of the sequences identified in Table 7, below.
  • sequences are available from the IMGT database (http://imgt.cines.fr:8104/textes/ IMGTrepertoire), and each sequence as identified by its accession number is expressly incorporated herein by reference in its entirety.
  • the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide comprising an amino acid sequence at Kabat positions 8 to 13 of the heavy chain variable region, or any subset thereof (e.g., positions 9 to 12, positions 10-12, etc.) according to any one of the sequences presented in Table 8 below.
  • the present invention is directed to an isolated polypeptide comprising an amino acid sequence at Kabat positions 8 to 13, or any subset thereof (e.g., positions 9 to 12, 10 to 12, etc.) according to any one of the sequences presented in Table 8 below.
  • the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide comprising an amino acid sequence at Kabat positions 108 to 113 of the heavy chain variable region, or any subset thereof (e.g., positions 110 to 112, positions 110 and 112, etc.).
  • the sequence at positions 108 to 113 is as shown in Table 9 below
  • the present invention is directed to an isolated polypeptide comprising an amino acid sequence at Kabat positions 108 to 113, or any subset thereof (e.g., positions 110 to 112, positions 110 and. 112, etc.) according to any one of the sequences presented in Table 9 below.
  • the present invention is directed to an expression vector and/or a host cell which comprise one or more isolated polynucleotides of the present invention.
  • any type of cultured cell line can be used to express the ABMs of the present invention, hi a preferred embodiment, CHO cells, HEK293-EBNA cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, other mammalian cells, yeast cells, insect cells, or plant cells are used as the background cell line to generate the engineered host cells of the invention.
  • the ABMs of the present invention comprising one or more amino acid substitutions in the heavy chain V and/or CHl regions and/or the light chain V and/or C regions may further comprise a human Fc region.
  • the human constant region is IgGl , as set forth in SEQ ID NOs 80 and 81, and set forth below:
  • variants and isoforms of the human Fc region are also encompassed by the present invention.
  • variant Fc regions suitable for use in the present invention can be produced according to the methods taught in U.S. Pat. No. 6,737,056 to Presta (Fc region variants with altered effector function due to one or more amino acid modifications); or in U.S. Pat. Appl. Nos. 60/439,498; 60/456,041; 60/514,549; or WO 2004/063351 (variant Fc regions with increased binding affinity due to amino acid modification); or in U.S. Pat. Appl. No. 10/672,280 or WO 2004/099249 (Fc variants with altered binding to FcgammaR due to amino acid modification), the contents of each of which is herein incorporated by reference in its entirety.
  • the ABMs comprising one or more amino acid substitutions in the heavy chain V and/or CHl regions and/or the light chain V and/or C regions may further comprise an Fc region variant.
  • Fc region residues will be deleted or substituted.
  • the Fc regions herein comprising one or more amino acid modifications will preferably retain at least about 80%, and preferably at least about 90%, and most preferably at least about 95%, of the parent Fc region sequence or of a native sequence human Fc region.
  • Fc ⁇ R Fc ⁇ receptor
  • FcRn Fc neonatal receptor
  • the parent polypeptide Fc region is a human Fc region, e.g. a native human Fc region human IgGl (A and non-A allotypes), IgG2, IgG3, IgG4, and all allotypes known or discovered from any species. Fc region.
  • human Fc region e.g. a native human Fc region human IgGl (A and non-A allotypes), IgG2, IgG3, IgG4, and all allotypes known or discovered from any species.
  • Fc region e.g. a native human Fc region human IgGl (A and non-A allotypes), IgG2, IgG3, IgG4, and all allotypes known or discovered from any species.
  • IgGl A and non-A allotypes
  • the parent polypeptide in order to generate an ABM comprising one or more amino acid substitutions in the heavy chain V and/or CHl regions and/or the light chain V and/or C regions and further comprising a modified Fc region with improved effector function (e.g., ADCC), the parent polypeptide preferably has pre-existing ADCC activity (e.g., the parent polypeptide comprises a human IgGl or human IgG3 Fc region).
  • a modified Fc region with improved ADCC mediates ADCC substantially more effectively than an . antibody with a native sequence IgGl or IgG3 Fc region.
  • amino acid modification(s) are introduced into the CH2 domain of the parent Fc region.
  • polypeptides of the invention having modified Fc regions may be subjected to one or more further modifications, depending on the desired or intended use of the polypeptide.
  • modifications may involve, for example, further alteration of the amino acid sequence (substitution, insertion and/or deletion of amino acid residues), fusion to heterologous polyp eptide(s) and/or covalent modifications.
  • further modifications may be made prior to, simultaneously with, or following, the amino acid modification(s) disclosed above which result in an alteration of Fc receptor binding and/or effector function.
  • the starting polypeptide of particular interest in this regard herein is one that binds to CIq and displays complement dependent cytotoxicity (CDC).
  • Amino acid substitutions described herein may serve to alter the ability of the starting polypeptide to bind to CIq and/or modify its complement dependent cytotoxicity function (e.g. to reduce and preferably abolish these effector functions).
  • polypeptides comprising substitutions at one or more of the described positions with improved CIq binding and/or complement dependent cytotoxicity (CDC) function are contemplated herein.
  • the starting polypeptide may be unable to bind CIq and/or mediate CDC and may be modified according to the teachings herein such that it acquires these further effector functions.
  • polypeptides with pre-existing CIq binding activity, optionally further having the ability to mediate CDC may be modified such that one or both of these activities are enhanced.
  • Amino acid modifications that alter CIq and/or modify its complement dependent cytotoxicity function are described, for example, in WO00/42072, which is hereby incorporated by reference.
  • one can design an Fc region or portion thereof with altered effector function e.g., by modifying CIq binding and/or FcR binding and thereby changing CDC activity and/or ADCC activity.
  • Another type of amino acid substitution serves to alter the glycosylation pattern of the polypeptide. This may be achieved, for example, by deleting one or more carbohydrate moieties found in the polypeptide, and/or adding one or more glycosylation sites that are not present in the polypeptide.
  • Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
  • the peptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
  • O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
  • the present invention provides compositions comprising a modification of a parent polypeptide having an Fc region, wherein the modified Fc region comprises at least one surface residue amino acid modification (See e.g.,Dns&rihofer, Biochemistry, 28;20(9):2361-70, April 1981, and WO00/42072, both of which are hereby incorporated by reference).
  • the present invention provides compositions comprising a modification of a parent polypeptide having an Fc region, wherein the modified Fc region comprises at least one non-surface residue amino acid modification.
  • the present invention comprises a variant of a parent polypeptide having an Fc region, wherein the variant comprises at least one surface amino acid modification and at least one non-surface amino acid modification.
  • the therapeutic efficacy of the modified ABMs of the present invention can be further enhanced by producing them in a host cell that has been glycoengineered to have altered expression of at least one glycoprotein- modifying glcyosyltransferase.
  • the glycoengineered host cell further expresses one or more of the following: a polynucleotide encoding a polypeptide having GnTHI activity, a polynucleotide encoding a polypeptide having ManII activity, or a polynucleotide encoding a polypeptide having GaIT activity.
  • the host cell expresses a polynucleotide encoding a polypeptide having GnTIII activity or ManH activity.
  • the host cell expresses a polynucleotide encoding a polypetide having GnTIII activity as well as a polynucleotide encoding a polypeptide having ManII activity.
  • the polypeptide having GnTIII activity is a fusion polypeptide comprising the Golgi localization domain of a Golgi resident polypeptide.
  • the expression of the modified ABMs of the present invention in a host cell that expresses a polynucleotide encoding a polypeptide having GnTIII activity results in modified ABMs with increased Fc receptor binding affinity and increased effector function.
  • the present invention is directed to a host cell comprising (a) an isolated nucleic acid comprising a sequence encoding a polypeptide having GnTIII activity; and (b) an isolated polynucleotide encoding an ABM of the present invention, such as a chimeric, primatized or humanized antibody that binds human CD20.
  • the polypeptide having GnTHI activity is a fusion polypeptide comprising the catalytic domain of GnTIII and the Golgi localization domain is the localization domain of mannosidase II.
  • the chimeric ABM is a chimeric antibody or a fragment thereof, having the binding specificity of the murine B-LyI antibody.
  • the chimeric antibody comprises a human Fc.
  • the antibody is primatized or humanized.
  • one or several polynucleotides encoding an ABM of the present invention may be expressed under the control of a constitutive promoter or, alternately, a regulated expression system.
  • Suitable regulated expression systems include, but are not limited to, a tetracycline-regulated expression system, an ecdysone-inducible expression system, a lac-switch expression system, a glucocorticoid-inducible expression system, atemperature- inducible promoter system, and a metallothionein metal-inducible expression system. If several different nucleic acids encoding an ABM of the present invention are comprised within the host cell system, some of them may be expressed under the control of a constitutive promoter, while others are expressed under the control of a regulated promoter.
  • the maximal expression level is considered to be the highest possible level of stable polypeptide expression that does not have a significant adverse effect on cell growth rate, and will be determined using routine experimentation.
  • Expression levels are determined by methods generally known in the art, including Western blot analysis using an antibody specific for the ABM or an antibody specific for a peptide tag fused to the ABM; and Northern blot analysis.
  • the polynucleotide may be operatively linked to a reporter gene; the expression levels of a modified ABM having substantially the same binding specificity of a parent antibody are determined by measuring a signal correlated with the expression level of the reporter gene.
  • the reporter gene may be transcribed together with the nucleic acid(s) encoding said fusion polypeptide as a single mRNA molecule; their respective coding sequences may be linked either by an internal ribosome entry site (IRES) or by a cap-independent translation enhancer (CITE).
  • the reporter gene may be translated together with at least one nucleic acid encoding a modified ABM having substantially the same binding specificity of a parent antibody such that a single polypeptide chain is formed.
  • the nucleic acids encoding the AMBs of the present invention may be operatively linked to the reporter gene under the control of a single promoter, such that the nucleic acid encoding the fusion polypeptide and the reporter gene are transcribed into an RNA molecule which is alternatively spliced into two separate messenger RNA (mRNA) molecules; one of the resulting mRNAs is translated into said reporter protein, and the other is translated into said fusion polypeptide.
  • mRNA messenger RNA
  • a variety of host-expression vector systems may be utilized to express the coding sequence of the ABMs of the present invention.
  • mammalian cells are used as host cell systems transfected with recombinant plasmid DNA or cosmid DNA expression vectors containing the coding sequence of the protein of interest and the coding sequence of the fusion polypeptide.
  • CHO cells, HEK293-EBNA cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, other mammalian cells, yeast cells, insect cells, or plant cells are used as host cell system.
  • yeast cells transformed with recombinant yeast expression vectors containing the coding sequence of an ABM of the present invention such as the expression systems taught in U.S. Pat. Appl. No.
  • WO 03/056914 methods for producing human-like glycoprotein in a non-human eukaryotic host cell (the contents of each of which are incorporated by reference in their entirety); insect cell systems infected with recombinant virus expression vectors (e.g., baculo virus) containing the coding sequence of a modified ABM having substantially the same binding specificity of a parent antibody; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing the coding sequence of the ABM of the invention, including, but not limited to, the expression systems taught in U.S.
  • recombinant virus expression vectors e.g., baculo virus
  • plant cell systems infected with recombinant virus expression vectors e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV
  • Pat. No. 6,815, 184 methods for expression and secretion of biologically active polypeptides from genetically engineered duckweed
  • WO 2004/057002 production of glycosylated proteins in bryophyte plant cells by introduction of a glycosyl transferase gene
  • WO 2004/024927 methods of generating extracellular heterologous non-plant protein in moss protoplast
  • 60/365,769, 60/368,047, and WO 2003/078614 glycoprotein processing in transgenic plants comprising a functional mammalian GnTIII enzyme
  • animal cell systems infected with recombinant virus expression vectors e.g., adenovirus, vaccinia virus
  • virus expression vectors e.g., adenovirus, vaccinia virus
  • the vector comprising the polynucleotide(s) encoding the ABM of the invention is polycistronic.
  • the ABM discussed above is an antibody or a fragment thereof.
  • the ABM is a humanized antibody.
  • stable expression is generally preferred to transient expression because it typically achieves more reproducible results and also is more amenable to large-scale production.
  • host cells can be transformed with the respective coding nucleic acids controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
  • engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media.
  • the selectable marker in the recombinant plasmid confers resistance to the selection and allows selection of cells which have stably integrated the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
  • a number of selection systems may be used, including, but not limited to, the herpes simplex virus thymidine kinase (Wigler et al, Cell 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. Sd. USA 48:2026 (1962)), and adenine phosphoribosyltransferase (Lowy et al, Cell 22:817 (1980)) genes, which can be employed in tk " , hgprt " or aprf cells, respectively.
  • antimetabolite resistance can be used as the basis of selection for dhfr, which confers resistance to methotrexate (Wigler et al, Natl Acad. Sd. USA 77:3567 (1989); O ⁇ are et al, Proc. Natl Acad. ScL USA 78: 1527 (1981)); gpt, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc. Natl Acad. ScL USA 78:2072 (1981)); neo, which confers resistance to the aminoglycoside G-418 (Colberre-Garapin et al, J.
  • the present invention is further directed to a method for modifying the glycosylation profile of the modified ABMs comprising at least one amino acid substitution in the V or CHl region that are produced by a host cell, comprising expressing in said host cell a nucleic acid encoding a modified ABM of the invention and a nucleic acid encoding a polypeptide with GnTIII activity, or a vector comprising such nucleic acids.
  • the modified polypeptide is IgG or a fragment thereof comprising the Fc region.
  • the ABM is a humanized antibody or a fragment thereof.
  • the host cell is engineered to coexpress an ABM of the invention, GnTIII and mannosidase II (ManII).
  • the modified ABMs produced by the host cells of the invention exhibit increased Fc receptor binding affinity and/or increased effector function as a result of the modification.
  • the modified ABM is a humanized antibody or a fragment thereof containing the Fc region.
  • the increased Fc receptor binding affinity is increased binding to a Fc ⁇ activating receptor, such as the Fc ⁇ RIIIa receptor.
  • the increased effector function is preferably an increase in one or more of the following: increased antibody-dependent cellular cytotoxicity, increased antibody-dependent cellular phagocytosis (ADCP), increased cytokine secretion, increased immune-complex- mediated antigen uptake by antigen-presenting cells, increased Fc-mediated cellular cytotoxicity, increased binding to NK cells, increased binding to macrophages, increased binding to polymorphonuclear cells (PMNs), increased binding to monocytes, increased crosslinking of target-bound antibodies, increased direct signaling inducing apoptosis, increased dendritic cell maturation, and increased T cell priming.
  • ADCP antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • cytokine secretion increased immune-complex- mediated antigen uptake by antigen-presenting cells
  • Fc-mediated cellular cytotoxicity increased binding to NK cells
  • macrophages increased binding to macrophages
  • PMNs polymorphonucle
  • Effector functions can be measured and/or determined by various assays known to those of skill in the art.
  • Various assays for measuring effector functions including Fc receptor binding affinity and complement dependent cytotoxicity, are described in US Application Publication No.2004/0241817Al, which is herein incorporated by reference in its entirety.
  • Cytokine secretion can be measured, for example, using a sandwich ELISA, see, e.g., McRae et al, J. Immunol. 164: 23-28 (2000) and the cytokine sandwich ELISA protocol available at www.bdbiosciences.com/pharmingen/protocols, or by the methods described in Takahashi et al, British J. Pharmacol.
  • Dendritic cell maturation for example, can be determined using assays as set forth by Kalergis and Ravetch, J. Exp. Med. 195: 1653-59 (2002), which is herein incorporated by reference in its entirety.
  • Examples of phagocytosis and antigen uptake/presentation assays are provided by Gresham et al, J. Exp. Med. 191: 515-28 (2000); Krauss et al, J. Immunol 153: 1769-77 (1994); wX Rafiq et al, J. Clin. Invest. 110: 71-79 (2002), and Hamano et al, J.
  • the present invention is also directed to a method for producing an ABM of the present invention, having modified oligosaccharides in a host cell comprising (a) culturing a host cell engineered to express at least one nucleic acid encoding a polypeptide having GnTIII activity under conditions which permit the production of an ABM according to the present invention, wherein said polypeptide having GnTIII activity is expressed in an amount sufficient to modify the oligosaccharides in the Fc region of said ABM produced by said host cell; and (b) isolating said ABM.
  • the polypeptide having GnTm activity is a fusion polypeptide comprising the catalytic domain of GnTi ⁇ .
  • the fusion polypeptide further comprises the Golgi localization domain of a Golgi resident polypeptide.
  • the Golgi localization domain is the localization domain of mannosidase II or GnTI.
  • the Golgi localization domain is selected from the group consisting of: the localization domain of mannosidase I, the localization domain of GnTII, and the localization domain of ⁇ 1-6 core fucosyltransferase.
  • the ABMs produced by the methods of the present invention have increased Fc receptor binding affinity and/or increased effector function.
  • the increased effector function is one or more of the following: increased Fc-mediated cellular cytotoxicity (including increased antibody- dependent cellular cytotoxicity), increased antibody-dependent cellular phagocytosis (ADCP), increased cytokine secretion, increased immune-complex- mediated antigen uptake by antigen-presenting cells, increased binding to NK cells, increased binding to macrophages, increased binding to monocytes, increased binding to polymorphonuclear cells, increased direct signaling inducing apoptosis, increased crosslinking of target-bound antibodies, increased dendritic cell maturation, or increased T cell priming.
  • the increased Fc receptor binding affinity is preferably increased binding to Fc activating receptors such as Fc ⁇ RIIIa.
  • the ABM is a humanized antibody or a fragment thereof.
  • the present invention is directed to a modified
  • ABM having substantially the same binding specificity of a parent antibody produced by the methods of the invention which has an increased proportion of bisected oligosaccharides in the Fc region of said polypeptide. It is contemplated that such an ABM encompasses antibodies and fragments thereof comprising the Fc region. In a preferred embodiment, the ABM is a humanized antibody.
  • the percentage of bisected oligosaccharides in the Fc region of the ABM is at least 50%, more preferably, at least 60%, at least 70%, at least 80%, or at least 90%, and most preferably at least 90-95% of the total oligosaccharides, ⁇ n yet another embodiment, the ABM produced by the methods of the invention has an increased proportion of nonfucosylated oligosaccharides in the Fc region as a result of the modification of its oligosaccharides by the methods of the present invention. In one embodiment, the percentage of nonfucosylated oligosaccharides is at least 50%, preferably at least 60% to 70%, most preferably at least 75%.
  • the nonfucosylated oligosaccharides may be of the hybrid or complex type.
  • the ABM produced by the host cells and methods of the invention has an increased proportion of bisected, nonfucosylated oligosaccharides in the Fc region.
  • the bisected, nonfucosylated oligosaccharides may be either hybrid or complex.
  • the methods of the present invention may be used to produce ABMs in which at least 15%, more preferably at least 20%, more preferably at least 25%, more preferably at least 30%, more preferably at least 35% of the oligosaccharides in the Fc region of the ABM are bisected, nonfucosylated.
  • the methods of the present invention may also be used to produce polypeptides in which at least 15%, more preferably at least 20%, more preferably at least 25%, more preferably at least 30%, more preferably at least 35% of the oligosaccharides in the Fc region of the polypeptide are bisected hybrid nonfucosylated.
  • the present invention is directed to a modified
  • the increased effector function is one or more of the following: increased Fc- mediated cellular cytotoxicity (including increased antibody-dependent cellular cytotoxicity), increased antibody-dependent cellular phagocytosis (ADCP), increased cytokine secretion, increased immune-complex-mediated antigen uptake by antigen-presenting cells, increased binding to NK cells, increased binding to macrophages, increased binding to monocytes, increased binding to polymorphonuclear cells, increased direct signaling inducing apoptosis, increased crosslinking of target-bound antibodies, increased dendritic cell maturation, or increased T cell priming.
  • increased Fc- mediated cellular cytotoxicity including increased antibody-dependent cellular cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • ADCP antibody-dependent cellular phagocytosis
  • cytokine secretion increased immune-complex-mediated antigen uptake by antigen-presenting cells
  • increased binding to NK cells increased binding to macrophages
  • monocytes increased binding to
  • the increased Fc receptor binding affinity is increased binding to a Fc activating receptor, most preferably Fc ⁇ RIIIa.
  • the modified ABM is an antibody, an antibody fragment containing the Fc region, or a fusion protein that includes a region equivalent to the Fc region of an immunoglobulin.
  • the ABM is a humanized antibody.
  • compositions comprising Modified ABMs
  • the present invention is further directed to pharmaceutical compositions comprising the modified ABMs of the present invention and a pharmaceutically acceptable carrier.
  • the carrier material can be an organic or inorganic one suitable for eteral, percutaneous or parenteral administration.
  • Suitable carriers include water, gelatin, gum arabic, lactose, starch, magnesium stearate, talc, vegetable oils, polyalkylene-glycols, petroleum jelly and the like.
  • the pharmaceutical preparations may contain other pharmaceutically active agents. Additional additives such as flavoring agents, stabilizers, emulsifying agents, buffers and the like may be added in accordance with accepted practices of pharmaceutical compounding.
  • phrases "pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • the present invention is further directed to such pharmaceutical compositions for use in the treatment or prohpylaxis of cancer.
  • the present invention is further directed to a method for the treatment or prophylaxis of cancer comprising administering a therapeutically effective amount of the pharmaceutical composition of the invention.
  • the cancer is selected from the group consisting of breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
  • the present invention is further directed to such pharmaceutical compositions for use in the treatment or prophylaxis of a precancerous condition or lesion.
  • the present invention is further directed to a method for the treatment or prophylaxis of a precancerous condition or lesion comprising administering a therapeutically effective amount of the pharmaceutical composition of the invention.
  • the precancerous condition or lesion is selected from the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
  • the present invention further provides methods for the generation and use of host cell systems for the production of glycoforms of the modified ABMs of the present invention, having increased Fc receptor binding affinity, preferably increased binding to Fc activating receptors, and/or having increased effector functions, including antibody-dependent cellular cytotoxicity.
  • the glycoengineering methodology that can be used with the modified ABMs of the present invention has been described in greater detail in U.S. Pat. No. 6,602,684 and Provisional U.S. Patent Application No. 60/441 ,307 and WO 2004/065540, the entire contents of each of which is incorporated herein by reference in its entirety.
  • modified ABMs of the present invention can alternatively be glyco engineered to have reduced fucose residues in the Fc region according to the techniques disclosed in EP 1 176 195 Al, the entire contents of which is incorporated by reference herein. Generation Of Cell Lines For The Production Of Modified ABMs With Altered Glycosylation Pattern
  • the present invention provides host cell expression systems for the generation of the modified ABMs of the present invention having modified glycosylation patterns.
  • the present invention provides host cell systems for the generation of glycoforms of the modified ABMs of the present invention having an improved therapeutic value. Therefore, the invention provides host cell expression systems selected or engineered to express a polypeptide having GnTHI activity.
  • the polypeptide having GnTi ⁇ activity is a fusion polypeptide comprising the Golgi localization domain of a heterologous Golgi resident polypeptide.
  • host cell expression systems may be engineered to comprise a recombinant nucleic acid molecule encoding a polypeptide having GnTIII, operatively linked to a constitutive or regulated promoter system.
  • the present invention provides ahost cell that has been engineered to express at least one nucleic acid encoding a fusion polypeptide having GnTIII activity and comprising the Golgi localization domain of a heterologous Golgi resident polypeptide.
  • the host cell is engineered with a nucleic acid molecule comprising at least one gene encoding a fusion polypeptide having GnTIII activity and comprising the Golgi localization domain of a heterologous Golgi resident polypeptide.
  • any type of cultured cell line including the cell lines discussed above, can be used as a background to engineer the host cell lines of the present invention, hi a preferred embodiment, CHO cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, other mammalian cells, yeast cells, insect cells, or plant cells are used as the background cell line to generate the engineered host cells of the invention.
  • the invention is contemplated to encompass any engineered host cells expressing a polypeptide having GnTIII activity, including a fusion polypeptide that comprises the Golgi localization domain of a heterologous Golgi resident polypeptide as defined herein.
  • nucleic acids encoding a polypeptide having GnTIII activity may be expressed under the control of a constitutive promoter or, alternately, a regulated expression system. Such systems are well known in the art, and include the systems discussed above. If several different nucleic acids encoding fusion polypeptides having GnTIII activity and comprising the Golgi localization domain of a heterologous Golgi resident polypeptide are comprised within the host cell system, some of them may be expressed under the control of a constitutive promoter, while others are expressed under the control of a regulated promoter.
  • Expression levels of the fusion polypeptides having GnTIII activity are determined by methods generally known in the art, including Western blot analysis, Northern blot analysis, reporter gene expression analysis or measurement of GnTIII activity.
  • a lectin may be employed which binds to biosynthetic products of the GnTIII, for example, E 4 -PHA lectin.
  • a functional assay which measures the increased Fc receptor binding or increased effector function mediated by antibodies produced by the cells engineered with the nucleic acid encoding a polypeptide with GnTIII activity may be used.
  • the host cells which contain the coding sequence of a modified ABM of the present invention and which express the biologically active gene products may be identified by at least four general approaches; (a) DNA-DNA or DNA- PvNA hybridization; (b) the presence or absence of "marker" gene functions; (c) assessing the level of transcription as measured by the expression of the respective rnRNA transcripts in the host cell; and (d) detection of the gene product as measured by immunoassay or by its biological activity.
  • ABM of the present invention and the coding sequence of the polypeptide having GnTIII activity can be detected by DNA-DNA or DNA-RNA hybridization using probes comprising nucleotide sequences that are homologous to the respective coding sequences, respectively, or portions or derivatives thereof.
  • the recombinant expression vector/host system can be identified and selected based upon the presence or absence of certain "marker" gene functions (e.g. , thymidine kinase activity, resistance to antibiotics, resistance to methotrexate, transformation phenotype, occlusion body formation in baculovirus, etc.).
  • certain "marker" gene functions e.g. , thymidine kinase activity, resistance to antibiotics, resistance to methotrexate, transformation phenotype, occlusion body formation in baculovirus, etc.
  • a marker gene can be placed in tandem with the coding sequences under the control of the same or different promoter used to control the expression of the coding sequences. Expression of the marker in response to induction or selection indicates expression of the coding sequence of the modified ABM of the invention and the coding sequence of the polypeptide having GnTIII activity.
  • transcriptional activity for the coding region of the modified ABM of the invention, or a fragment thereof, and the coding sequence of the polypeptide having GnTIII activity can be assessed by hybridization assays.
  • RNA canbe isolated and analyzed by Northern blot using a probe homologous to the coding sequences of the modified ABM of the invention, or a fragment thereof, and the coding sequence of the polypeptide having GnTIII activity or particular portions thereof.
  • total nucleic acids of the host cell may be extracted and assayed for hybridization to such probes.
  • the expression of the protein products can be assessed immunologically, for example by Western blots, immunoassays such as radioimmuno-precipitation, enzyme-linked immunoassays and the like.
  • immunoassays such as radioimmuno-precipitation
  • enzyme-linked immunoassays and the like.
  • the ultimate test of the success of the expression system involves the detection of the biologically active gene products.
  • the present invention provides glycoforms of chimeric modified ABMs having substantially the same binding specificity of the murine B-LyI antibody and having increased effector function including antibody-dependent cellular cytotoxicity.
  • Glycosylation engineering of antibodies has been previously described. See, e.g., U.S. Patent No. 6,602,684, incorporated herein by reference in its entirety.
  • Clinical trials of unconjugated monoclonal antibodies (mAbs) for the treatment of some types of cancer have recently yielded encouraging results. Dillman, Cancer Biother. & Radiopharm. 12:223-25 (1997); Deo et al, Immunology Today 18:127 (1997).
  • a chimeric, unconjugated IgGl has been approved for low-grade or follicular B-cell non-Hodgkin's lymphoma. Dillman, Cancer Biother. & Radiopharm. 12:223-25 (1997), while another unconjugated niAb, a humanized IgGl targeting solid breast tumors, has also been showing promising results in phase III clinical trials. Deo et al, Immunology Today 18:127 (1997). The antigens of these two mAbs are highly expressed in their respective tumor cells and the antibodies mediate potent tumor destruction by effector cells in vitro and in vivo.
  • a different, but complementary, approach to increase ADCC activity of unconjugated IgGIs is to engineer the Fc region of the antibody.
  • Protein engineering studies have shown that Fc ⁇ Rs interact with the lower hinge region ofthe IgG CH2 domain. Ixmd etal., J. Immunol. 157:4963-69 (1996).
  • Fc ⁇ R binding also requires the presence of oligosaccharides covalently attached at the conserved Asn 297 in the CH2 region. Lund et al, J. Immunol 157:4963- 69 (1996); Wright and Morrison, Trends Biotech.
  • An IgG molecule carries two N-linked oligosaccharides in its Fc region, one on each heavy chain.
  • an antibody is produced as a population of glycoforms which share the same polypeptide backbone but have different oligosaccharides attached to the glycosylation sites.
  • the oligosaccharides normally found in the Fc region of serum IgG are of complex bi-antennary type (Wormald et al, Biochemistry 5(5:130-38 (1997), with a low level of terminal sialic acid and bisecting N-acetylglucosamine (GIcNAc), and a variable degree of terminal galactosylation and core fucosylation.
  • the CAMPATH antigen is normally present at high levels on lymphoma cells, and this chimeric niAb has high ADCC activity in the absence of a bisecting GIcNAc. Lifely et al, Glycobiology 375:813-22 (1995). In the N- linked glycosylation pathway, a bisecting GIcNAc is added by GnTIII. Schachter, Biochem. Cell Biol. 54:163-81 (1986).
  • the increased GnTIII activity results in an increase in the percentage of bisected oligosaccharides, as well as a decrease in the percentage of fucose residues, in the Fc region of the modified ABM.
  • This antibody, or fragment thereof has increased Fc receptor binding affinity and increased effector function.
  • the invention is directed to antibody fragment and fusion proteins comprising a region that is equivalent to the Fc region of immunoglobulins.
  • the modified ABMs of the present invention can be used to target cells in vivo or in vitro that express a target antigen, in particular, where said target antigen is expressed on the cell surface.
  • the cells expressing a target antigen can be targeted for diagnostic or therapeutic purposes.
  • the modified ABMs of the present invention can be used to alter cell signaling activity in cells expressing a target antigen.
  • the modified ABMs of the present invention can be used to alter the cross-linking and/or oligomerization of one or more target antigens.
  • Target antigens for the moified ABMs of the present invention can be cell surface receptors including, but not limited to CD20, CD21, CD22, CD19, CD47, CD99, CD2, CD45, Herl (EGFR), Her2/neu, Her3, Her4, TRAIL receptors (e.g., TRAILRl, TRAILR2), TNFR, FGF receptors (e.g., FGFRl), IGF receptors, PDGF receptors, VEGF receptors, and other cell-surface associated receptors.
  • the target antigen is CD20.
  • the modified ABMs of the invention also act to arrest the cell cycle, cause apoptosis of the target cells (e.g., tumor cells), inhibit angiogenesis and/or cause differentiation of target cells.
  • the invention is directed to a method for treating a disease that is treatable by altered cell signaling activity of a target antigen and/or by altered ability to mediate cross-linking of one or more target- antigens comprising administering a therapeutically effective amount of a modified ABM of the present invention to a subject in need thereof.
  • the modified ABM is an antibody.
  • the antibody is humanized. Examples of diseases for which the modified ABMs can be administered include, but are not limited to, cell proliferation diseases or disorders, autoimmune diseases or disorders, and diseases or disorders related to bacterial or viral infection.
  • the disease or disorder is a cell proliferation disorder.
  • Examples of cell proliferation disorders that can be treated by an ABM of the present invention include, but are not limited to, neoplasms, cancers, malignancies and/or tumors located in the abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal;, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system.
  • neoplasms neoplasms, cancers, malignancies and/or tumors located in the abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal;, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic,
  • neoplasms, cancers, malignancies, and/or tumors that can be treated with the ABMs of the invention include, but are not limited to, epidermal and squamous cell carcinomas, gliomas, pancreatic cancer, ovarian cancer, prostate cancer, breast cancer, bladder cancer, head and neck cancer, renal cell carcinomas, colon cancer, colorectal cancer, lung cancer, brain tumor, malignant melanoma, leukemia, lymphomas, T cell lymphomas, multiple myeloma, gastric cancer, cervical cancer, endometrial carcinoma, esophageal cancer, liver cancer, cutaneous cancer, urinary tract carcinoma, choriocarcinoma, pharyngeal cancer, laryngeal cancer, thecomatosis, androblastoma, endometrium hyperplasy, endometriosis, embryoma, fibrosarcoma, Kaposi's sarcoma, hemangioma, cavernous hemangioma
  • cell proliferation disorders can also be treated with the modified ABMs of the present invention.
  • cell proliferation disorders include, but are not limited to hypergammaglobulinemia, lymphoproliferative disorders, paraproteinemias, purpura, sarcoidosis, Sezary Syndrome, Waldenstron's Macroglobulinemia, Gaucher's Disease, histiocytosis, and any other cell proliferation disease, besides neoplasia, located in an organ system listed above.
  • autoimmune diseases or disorders include, but are not limited to, immune-mediated thrombocytopenias, such as acute idiopathic thrombocytopenic purpurea and chronic idiopathic thrombocytopenic purpurea, dermatomyositis, Sydenham's chorea, lupus nephritis, rheumatic fever, polyglandular syndromes, Henoch-Schonlein purpura, poststreptococcal nephritis, erythema nodosum, Takayasu's arteritis, Addison's disease, erythema multiforme, polyarteritis nodosa, ankylosing spondylitis, Goodpasture's syndrome, thromboangitis ubiterans, primary biliary cirrhosis, Hashimoto's thyroiditis, thyrotoxicosis, chronic active hepatitis, polymyosit
  • atopic dermatitis atopic dermatitis
  • systemic scleroderma and sclerosis responses associated with inflammatory bowel disease (such as Crohn's disease and ulcerative colitis); respiratory distress syndrome (including adult respiratory distress syndrome; ARDS); dermatitis; meningitis; encephalitis; uveitis; colitis; glomerulonephritis; allergic conditions such as eczema and asthma and other conditions involving infiltration of T cells and chronic inflammatory responses; atherosclerosis; leukocyte adhesion deficiency; rheumatoid arthritis; systemic lupus erythematosus (SLE); diabetes mellitus ⁇ e.g.
  • modified ABMs of the present invention can be used alone or in combination with other treatments or therapeutic agents to treat disorders that are treatable by increasing or decreasing cell signaling activity and/or cross-linking of one or more target antigens.
  • modified ABMs of the present can be used alone to target and kill tumor cells in vivo.
  • the modified ABMs can also be used in conjunction with an appropriate therapeutic agent to treat human carcinoma.
  • the modified ABMs can be used in combination with standard or conventional treatment methods such as chemotherapy, radiation therapy or can be conjugated or linked to a therapeutic drug, or toxin, as well as to a lymphokine or a tumor-inhibitory growth factor, for delivery of the therapeutic agent to the site of the carcinoma.
  • the conjugates of the modified ABMs of this invention include (1) immunotoxins (conjugates of the modified ABM and a cytotoxic moiety) and (2) labeled (e.g. radiolabeled, enzyme-labeled, or fluorochrome-labeled) modified ABMs in which the label provides a means for identifying immune complexes that include the labeled ABM.
  • the modified ABMs can also be used to induce lysis through the natural complement process, and to interact with antibody dependent cytotoxic cells normally present.
  • the cytotoxic moiety of the immunotoxin may be a cytotoxic drug or an enzymatically active toxin of bacterial or plant origin, or an enzymatically active fragment ("A chain") of such a toxin.
  • Enzymatically active toxins and fragments thereof used are diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, and enomycin.
  • diphtheria A chain nonbinding active fragments of diphtheria toxin
  • exotoxin A chain from Pseudomonas aeruginosa
  • ricin A chain abrin A chain
  • modeccin A chain alpha-sarcin
  • the modified ABMs are conjugated to small molecule anticancer drugs.
  • Conjugates of the modified ABM and such cytotoxic moieties are made using a variety of bifunctional protein coupling agents.
  • bifunctional protein coupling agents include SPDP, IT, bifunctional derivatives of imidoesters such a dimethyl adipimidate HCl, active esters such as disuccinimidyl suberate, aldehydes such as glutaraldehyde, bis- azido compounds such as bis (p-azidobenzoyl) hexanediamine, bis-diazonium derivatives such as bis-(p-diazoniumbenzoyl)-ethylenediamine, diisocyanates such as tolylene 2,6-diisocyanate, and bis-active fluorine compounds such as 1,5- difluoro-2,4-dinitrobenzene.
  • the lysing portion of a toxin may be joined to the Fab fragment of the modified ABMs.
  • Additional appropriate toxins are known in the art, as evidenced in e.g., published U.S. Patent Application No. 2002/0128448, incorporated herein by reference in its entirety.
  • the antigen binding molecule of the present invention is conjugated to an additional moiety, such as a radiolabel or a toxin.
  • conjugated modified ABMs can be produced by numerous methods that are well known in the art.
  • 131 iodine is a well known radionuclide used for targeted immunotherapy.
  • the clinical usefulness of 131 iodine can be limited by several factors including: eight-day physical half-life; dehalogenation of iodinated antibody both in the blood and at tumor sites; and emission characteristics (eg, large gamma component) which can be suboptimal for localized dose deposition in tumor.
  • 90 Yttrium provides several benefits for utilization in radioimmunotherapeutic applications: the 64 hour half- life of 9O yttrium is long enough to allow antibody accumulation by tumor and, unlike eg, 131 iodine, 90 yttrium is a pure beta emitter of high energy with no accompanying gamma irradiation in its decay, with a range in tissue of 100 to 1000 cell diameters. Furthermore, the minimal amount of penetrating radiation allows for outpatient administration of 90 yttrium-labeled antibodies. Additionally, internalization of labeled antibody is not required for cell killing, and the local emission of ionizing radiation should be lethal for adjacent tumor cells lacking the target antigen.
  • Effective single treatment dosages i.e., therapeutically effective amounts
  • 90 yttrium labeled modified ABMs of the present invention range from between about 5 and about 75 mCi, more preferably between about 10 and about 40 mCi.
  • Effective single treatment non-marrow ablative dosages of 13 iodine labeled ABMs of the present invention range from between about 5 and about 70 mCi, more preferably between about 5 and about 40 mCi.
  • Effective single treatment ablative dosages i.e., may require autologous bone marrow transplantation) of 1 iodine labeled antibodies of the present invention range from between about 30 and about 600 mCi, more preferably between about 50 and less than about 500 mCi.
  • an effective single treatment non-marrow ablative dosages of 131 iodine labeled chimeric antibodies range from between about 5 and about 40 mCi, more preferably less than about 30 mCi. Imaging criteria for, e.g., the m indium label, are typically less than about 5 mCi.
  • radiolabeled antibodies of the present invention therapy therewith can also occur using a single therapy treatment or using multiple treatments. Because of the radionuclide component, it is preferred that prior to treatment, peripheral stem cells (“PSC”) or bone marrow (“BM”) be “harvested” for patients experiencing potentially fatal bone marrow toxicity resulting from radiation. BM and/or PSC are harvested using standard techniques, and then purged and frozen for possible reinfusion.
  • PSC peripheral stem cells
  • BM bone marrow
  • a diagnostic dosimetry study using a diagnostic labeled antibody be conducted on the patient, a purpose of which is to ensure that the therapeutically labeled antibody (eg, using 90 yttrium) will not become unnecessarily "concentrated” in any normal organ or tissue.
  • a chimeric, glycoengineered modified ABM of the present invention is conjugated to ricin A chain.
  • the ricin A chain is deglycosylated and produced through recombinant means.
  • An advantageous method of making the ricin immunotoxin is described in Vitetta et al., Science 238, 1098 (1987), hereby incorporated by reference.
  • the conjugates When used to kill human cancer cells in vitro for diagnostic purposes, the conjugates will typically be added to the cell culture medium at a concentration of at least about 10 nM.
  • the formulation and mode of administration for in vitro use are not critical. Aqueous formulations that are compatible with the culture or perfusion medium will normally be used. Cytotoxicity may be read by conventional techniques to determine the presence or degree of cancer.
  • a cytotoxic radiopharmaceutical for treating cancer may be made by conjugating a radioactive isotope (e.g., I, Y, Pr) to a chimeric, glycoengineered and/or modified ABM of the present invention.
  • a radioactive isotope e.g., I, Y, Pr
  • the term "cytotoxic moiety" as used herein is intended to include such isotopes.
  • liposomes are filled with a cytotoxic drug and the liposomes are coated with the ABMs of the present invention. Because many of the target molecules for the modified ABMs of the present invention expressed on the cell surface (e.g., there are many CD20 molecules on the surface of the malignant B-cell), this method permits delivery of large amounts of drug to the correct cell type.
  • Still other therapeutic applications for the ABMs of the invention include conjugation or linkage, e.g., by recombinant DNA techniques, to an enzyme capable of converting a prodrug into a cytotoxic drug and the use of that antibody-enzyme conjugate in combination with the prodrug to convert the prodrug to a cytotoxic agent at the tumor site (see, e.g., Senter et al., "Anti-Tumor Effects of Antibody-alkaline Phosphatase", Proc. Natl. Acad.
  • Still another therapeutic use for the ABMs ofthe invention involves use, either unconjugated, in the presence of complement, or as part of an antibody-drug or antibody-toxin conjugate, to remove tumor cells from the bone marrow of cancer patients.
  • autologous bone marrow may be purged ex vivo by treatment with the antibody and the marrow infused back into the patient (see, e.g., Ramsay et al., "Bone Marrow Purging Using Monoclonal Antibodies", J. Clin. Immunol, 8(2):81-88 (1988)).
  • the invention comprises a single-chain immunotoxin comprising antigen binding domains that allow substantially the same specificity of binding as a parent antibody (e.g., polypeptides comprising the CDRs of the parent antibody) and further comprising a toxin polypeptide.
  • the single-chain immunotoxins of the invention may be used to treat human carcinoma in vivo.
  • fusion protein comprising at least the antigen-binding region of an ABM of the invention joined to at least a functionally active portion of a second protein having anti-rumor acitivty, e.g., a lymphokine or oncostatin, can be used to treat human carcinoma in vivo.
  • a fusion protein comprising at least the antigen-binding region of an ABM of the invention joined to at least a functionally active portion of a second protein having anti-rumor acitivty, e.g., a lymphokine or oncostatin, can be used to treat human carcinoma in vivo.
  • the present invention provides a method for selectively killing tumor cells expressing cell surface receptors including, but not limited to CD20, Herl (EGFR), Her2/neu, Her3, Her4, TRAIL receptors (e.g., TRAILRl, TRAILR2), TNFR, FGF receptors (e.g., FGFRl), IGF receptors, PDGF receptors, VEGF receptors, and other cell-surface associated receptors.
  • This method comprises reacting the modified ABM of the invention (conjugated, e.g., as an immunotoxin, or unconjugated) with said tumor cells.
  • These tumor cells maybe from a human carcinoma.
  • this invention provides a method of treating carcinomas (for example, human carcinomas) in vivo.
  • This method comprises administering to a subject a pharmaceutically effective amount of a composition containing at least one of the modified ABMs of the invention (conjugated, e.g., as an immunotoxin, or unconjugated).
  • the invention is directed to an improved method for treating B-cell proliferative disorders including B-cell lymphoma, as well as an autoimmune disease produced in whole or in part by pathogenic autoantibodies, based on B-cell depletion comprising administering a therapeutically effective amount of an ABM of the present invention to a human subject in need thereof.
  • the ABM is a glycoengineered anti-CD20 antibody with a binding specificity substantially the same as that of the murine B-LyI antibody.
  • the antibody is humanized.
  • the ABMs of the invention are used to deplete the blood of normal B-cells for an extended period.
  • the subject may be a human, equine, porcine, bovine, murine, canine, feline, and avian subjects. Other warm blooded animals are also included in this invention.
  • the subj ect invention further provides methods for inhibiting the growth of human tumor cells, treating a tumor in a subject, and treating a proliferative type disease in a subject. These methods comprise administering to the subject an effective amount of the composition of the invention.
  • the invention relates to an ABM according to the present invention for use in the treatment or prophylaxis of cancer, a precancerous condition or lesion, or an autoimmune disorder.
  • the invention relates to an ABM according to the present invention for use as a medicament for the treatment or prophylaxis of cancer, a precancerous condition or lesion, or an autoimmune disease.
  • the cancer may be, for example, B-cell lymphoma, lung cancer, non small cell lung (NSCL) cancer, broncbioalviolar cell lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, me
  • the precancerous condition or lesion includes, for example, the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
  • the cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer. Examples of autoimmune disorders are
  • Yet another embodiment is the use of the ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer or for the treatment or prophylaxis of a precancerous condition or lesion.
  • Cancer and precancerous condition or lesion are defined as above.
  • the present invention encompasses pharmaceutical compositions, combinations, uses, and methods for treating human carcinomas.
  • the invention includes pharmaceutical compositions for use in the treatment of human carcinomas comprising a pharmaceutically effective amount of an antibody of the present invention and a , pharmaceutically acceptable carrier.
  • compositions of the invention can be administered using conventional modes of administration including, but not limited to, intravenous, intraperitoneal, oral, intralymphatic or administration directly into the tumor. Intravenous administration is preferred.
  • ABMs of the invention are prepared for storage by mixing an antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions.
  • Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
  • Exemplary anti-CD20 ABM formulations are described in WO98/56418, expressly incorporated herein by reference.
  • This publication describes a liquid multidose formulation comprising 40 mg/mL rituximab, 25 mM acetate, 150 mM trehalose, 0.9% benzyl alcohol, 0.02% polysorbate 20 at pH 5.0 that has a minimum shelf life of two years storage at 2-8 0 C.
  • Another anti-CD20 formulation of interest comprises 10 mg/mL rituximab in 9.0 mg/mL sodium chloride, 7.35 mg/mL sodium citrate dihydrate, 0.7 mg/mL polysorbate 80, and Sterile Water for Injection, pH6.5.
  • rituximab will be substituted by a modified ABM of the present invention.
  • Lyophilized formulations adapted for subcutaneous administration are described in WO97/04801. Such lyophihized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the mammal to be treated herein.
  • the formulation herein ' may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • a cytotoxic agent, chemotherapeutic agent, cytokine or immunosuppressive agent e.g. one which acts on T cells, such as cyclosporin or an antibody that binds T cells, e.g., one which binds LFA-I.
  • the effective amount of such other agents depends on the amount of antagonist present in the formulation, the type of disease or disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as used hereinbefore or about from 1 to 99% of the heretofore employed dosages.
  • the active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly- (methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microenmlsions,nano- particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microenmlsions,nano- particles and nanocapsules
  • Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antagonist, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, ⁇ oly(2-hydroxyethyl- methacrylate), or ⁇ oly(vinylalcohol)), polylactides (U.S. Pat. No.
  • copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene- vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid.
  • formulations to be used for in vivo administration must be sterile.
  • compositions of the invention may be in a variety of dosage forms which include, but are not limited to, liquid solutions or suspension, tablets, pills, powders, suppositories, polymeric microcapsules or microvesicles, liposomes, and injectable or infusible solutions.
  • dosage forms include, but are not limited to, liquid solutions or suspension, tablets, pills, powders, suppositories, polymeric microcapsules or microvesicles, liposomes, and injectable or infusible solutions.
  • the preferred form depends upon the mode of administration and the therapeutic application.
  • compositions of the invention also preferably include conventional pharmaceutically acceptable carriers and adjuvants known in the art such as human serum albumin, ion exchangers, alumina, lecithin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, and salts or electrolytes such as protamine sulfate.
  • conventional pharmaceutically acceptable carriers and adjuvants known in the art such as human serum albumin, ion exchangers, alumina, lecithin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, and salts or electrolytes such as protamine sulfate.
  • compositions of this invention The most effective mode of administration and dosage regimen for the pharmaceutical compositions of this invention depends upon the severity and course of the disease, the patient's health and response to treatment and the judgment of the treating physician. Accordingly, the dosages of the compositions should be titrated to the individual patient. Nevertheless, an effective dose of the compositions of this invention will generally be in the range of from about 0.01 to about 2000 mg/kg.
  • the molecules described herein may be in a variety of dosage forms which include, but are not limited to, liquid solutions or suspensions, tablets, pills, powders, suppositories, polymeric microcapsules or microvesicles, liposomes, and inj ectable or infusible solutions. The preferred form depends upon the mode of administration and the therapeutic application.
  • the dosages of the present invention may, in some cases, be determined by the use of predictive biomarkers.
  • Predictive biomarkers are molecular markers that are used to determine (i.e., observe and/or quanitate) a pattern of expression and/or activation of tumor related genes or proteins, or cellular components of a tumor-related signaling pathway. Elucidating the biological effects of targeted therapies in tumor tissue and correlating these effects with clinical response helps identify the predominant growth and survival pathways operative in tumors, thereby establishing a profile of likely responders and conversely providing a rationale for designing strategies to overcoming resistance to therapy.
  • biomarkers for anti-EGFR therapy may comprise one or more molecules that are in the EGFR downstream signaling pathway leading to a cell proliferation disorder including, but not limited to, Akt, RAS, RAF, MAPK, ERKl, ERK2, PKC, STAT3, STAT5 (Mitchell, Nature Biotech. 22: 363-364 (2004); Becker, Nature Biotech 22: 15-18 (2004); Tsao and Herbst, Signal 4: 4-9 (2003)).
  • Biomarkers for anti-EGFR therapy may also comprise growth factor receptors such as EGFR, ErbB-2 (HER2/neu), and ErbB-3 (HER3), and may be positive or negative predictors of patient response to anti-EGFR therapy.
  • the growth factor receptor ErbB-3 (HER3) was determined to be a negative predictive biomarker for the anti-EGFR antibody ABX-EGF (U.S. Pat. Appl. Pub. No. 2004/0132097 Al).
  • Predictive biomarkers may be measured by cellular assays that are well known in the art including, but not limited to immunohistochemistry, flow cytometry, immunofluorescence, capture ⁇ and-detection assays, and reversed phase assays, and/or assays set forth in U.S. Pat. Appl. Pub. No. 2004/0132097 Al , the entire contents of which are herein incorporated by reference .
  • Predictive biomarkers of anti-EGFR therapy themselves, can be identified according to the techniques set forth in U.S. Pat. Appl. Pub. No. 2003/0190689A1, the entire contents of which are hereby incorporated by reference.
  • the present invention provides for a method for treating a disorder that is related to altered or dysregulated cell signaling hy a target antigen and/or altered ability to mediate cross-linking and/or oligomerization of one or more target antigens comprising predicting a response to therapy with a modified ABM in a human subject in need of treatment by assaying a sample from the human subject prior to therapy with one or aplurality of reagents that detect expression and/or activation of predictive biomarkers for disorder that is related to altered or dysregulated cell signaling by a target antigen and/or altered ability to mediate cross-linking and/or oligomerization of one or more target antigens (such as cancer); determining a pattern of expression and/or activation of one or more of the predictive biomarkers, wherein the pattern predicts the human subject's response to the modified ABM therapy; and administering to a human subject who is predicted to respond positively to modified ABM treatment a therapeutically effective amount
  • a human subject who is predicted to respond positively to modified ABM treatment is one for whom the modified ABM will have a measurable effect on the disease or disorder that is related to altered or dysregulated cell signaling by a target antigen and/or altered ability to mediate cross-linking and/or oligomerization of one or more target antigens (e.g., tumor regression/shrinkage) and for whom the benefits of modified ABM therapy are not outweighed by adverse effects (e.g., toxicity).
  • target antigens e.g., tumor regression/shrinkage
  • a sample means any biological sample from an organism, particularly a human, comprising one or more cells, including single cells of any origin, tissue or biopsy samples which has been removed from organs such as breast, lung, gastrointestinal tract, skin, cervix, ovary, prostate, kidney, brain, head and neck, or any other other organ or tissue of the body, and other body samples including, but not limited to, smears, sputum, secretions, cerebrospinal fluid, bile, blood, lymph fluid, urine and feces.
  • composition comprising a modified ABM of the present invention will be formulated, dosed, and administered in a fashion consistent with good medical practice.
  • Factors for consideration in this context include the particular disease or disorder being treated, the particular mammal being treated, the clinic condition of the individual patient, the cause of the disease or disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
  • the therapeutically effective amount of the antagonist to be administered will be governed by such considerations.
  • the therapeutically effective amount of the antibody administered parenterally per dose will be in the range of about 0.1 to 20 mg/kg of patient body weight per day, with the typical initial range of antagonist used being in the range of about 2 to 10 mg/kg.
  • the modified ABM is used in a therapeutically effective amount from about 1.0 mg/kg to about 15 mg/kg.
  • the modified ABM is used in a therapeutically effective amount from about 1.5 mg/kg to about 12 mg/kg.
  • the modified ABM is used in a therapeutically effective amount from about 1.5 mg/kg to about 4.5 mg/kg.
  • the modified ABM is used in a therapeutically effective amount from about 4.5 mg/kg to about 12 mg/kg.
  • the modified ABM is used in a therapeutically effective amount of about 1.5 mg/kg.
  • the modified ABM is used in a therapeutically effective amount of about 4.5 mg/kg.
  • the modified ABM is used in a therapeutically effective amount of about 12 mg/kg.
  • the modified ABM is an antibody, preferably a humanized antibody.
  • Suitable dosages for such an unconjugated antibody are, for example, in the range from about 20 mg/m to about 1000 mg/m .
  • the dosage of the antibody differs from that presently recommended for rituximab.
  • one may administer one or more initial dose(s) of the antibody followed by one or more subsequent dose(s), wherein the mg/m 2 dose of the antibody in the subsequent dose(s) exceeds the mg/m 2 dose of the antibody in the initial dose(s).
  • the initial dose may be in the range from about 20 mg/m 2 to about 250 mg/m 2 (e.g., from about 50 mg/m 2 to about 200mg/m 2 ) and the subsequent dose may be in the range from about 250 mg/m 2 to about 1000 mg/m 2 .
  • the modified ABM of the present invention is administered by any suitable means, including parenteral, subcutaneous, intraperitoneal, intrapulinonary, and intranasal, and, if desired for local immunosuppressive treatment, intralesional administration.
  • Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
  • the antagonist may suitably be administered by pulse infusion, e.g., with declining doses of the antagonist.
  • the dosing is given by injections, most preferably intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
  • the combined administration includes coadministration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities.
  • the pharmaceutical carrier may be a lipid carrier.
  • the lipid carrier may be a phospholipid.
  • the lipid carrier may be a fatty acid.
  • the lipid carrier may be a detergent.
  • a detergent is any substance that alters the surface tension of a liquid, generally lowering it.
  • the detergent may be a nonionic detergent.
  • nonionic detergents include, but are not limited to, polysorbate 80 (also known as Tween 80 or (polyoxyethylenesorbitan monooleate), Brij, and Triton (for example Triton WR-1339 and Triton A-20).
  • the detergent maybe an ionic detergent.
  • An example of an ionic detergent includes, but is not limited to, alkyltrimethylarnmonium bromide.
  • the lipid carrier may be a liposome.
  • a liposome is any membrane bound vesicle which contains any molecules of the invention or combinations thereof.
  • B-LyI expressing hybridoma cells see, e.g., Poppema, S., et ah, 1987,
  • cDNAs encoding the variable light and heavy chains of B- LyI were amplified by RT-PCR.
  • the RT-PCR reaction was performed using the following conditions: 30 min at 50 °C for the first strand cDNA synthesis; 15 min at 95 °C initial denaturation; 30 cycles of 1 min at 94 0 C, 1 min at 45 0 C, 1.5 min at 72 °C; and a final elongation step for 10 min at 72 0 C.
  • the expected size of the PCR products was confirmed by gel electrophoresis.
  • the PCR products were cloned into suitable E. coli vectors and DNA sequencing confirmed that the variable light and heavy chain encoding genes were isolated.
  • variable chains For construction of chimeric B-LyI expression vectors, synthetic signal sequences and appropriate restriction sites were fused to the variable chains by additional PCR reactions. After a final confirmation of the correct DNA sequence of the variable chains, they were combined with the corresponding human IgGl constant regions. Once the genes were constructed, they were cloned under control of the MPSV promoter and upstream of a synthetic polyA site, using two separate vectors, one for each chain, resulting in the plasmids pETRl 808 (heavy chain expression vector) and pETR1813 (light chain expression vector). Each vector carried an EBV OriP sequence.
  • Chimeric B-LyI was produced by co-transfecting HEK293-EBNA cells with vectors pETRl 808 and pETRl 813 using a calcium phosphate-transfection approach. Exponentially growing HEK293 -EBNA cells were transfected by the calcium phosphate method. Cells were grown as adherent monolayer cultures in T flasks using DMEM culture medium supplemented with 10% FCS, and were transfected when they were between 50 and 80% confluent.
  • a solution of DNA, CaCl 2 and water was prepared by mixing 47 ⁇ g total plasmid vector DNA divided equally between the light and heavy chain expression vectors, 235 ⁇ l of a IM CaCl 2 solution, and adding water to a final volume of 469 ⁇ l.
  • the cells were co-transfected with four plasmids, two for antibody expression (pETR1808 and pETR1813), one for a fusion GnTIII polypeptide expression ( ⁇ ETR1519), and one for mannosidase II expression (pCLF9) at a ratio of 4:4: 1 : 1 , respectively.
  • pETR1808 and pETR1813 two for antibody expression
  • ⁇ ETR1519 a fusion GnTIII polypeptide expression
  • pCLF9 mannosidase II expression
  • chB-Lyl and chB-Lyl-ge were purified from culture supernatant using three sequential chromatographic steps, Protein A chromatography, cation exchange chromatography, and a size exclusion chromatography step on a Superdex 200 column (Amersham Pharmacia) exchanging the buffer to phosphate buffer saline and collecting the monomeric antibody peak from this last step.
  • Antibody concentration was estimated using a spectrophotometer from the absorbance at 280 nm.
  • the resulting digest solution containing the released oligosaccharides was either prepared directly for MALDI7TOF-MS analysis or was further digested with EndoH glycosidase prior to sample preparation for MALDI/TOF-MS analysis.
  • N-linked oligosaccharides were released by addition of 2.5 mU peptide-
  • N-glycosydase F recombinat N-Glycanase, GLYKO, Novato, CA
  • 0.1 mU Sialidase GLYKO 5 Novato, CA
  • Endoglycosidase H (EC 3.2.1.96). For the EndoH digestion, 15 mU of EndoH (Roche, Switzerland) were added to the PNGaseF digest (antibody in solution method above) to give a final volume of 30 ⁇ l, and the mix was incubated for 3 hours at 37°C. EndoH cleaves between the N-acetylglucosamine residues of the 1 chitobiose core of N-linked oligosaccharides. The enzyme can only digest oligomannose and most hybrid type glycans, whereas complex type oligosaccharides are not hydrolyzed.
  • sDHB matrix was prepared by dissolving 2 mg of 2,5- dihydroxybenzoic acid plus 0.1 mg of 5-methoxysalicylic acid in 1 ml of ethanol/10 mM aqueous sodium chloride 1:1 (v/v). The samples were air dried, 0.2 ⁇ l ethanol was applied, and the samples were finally allowed to re-crystallize under air.
  • the MALDI-TOF mass spectrometer used to acquire the mass spectra was a Voyager Elite (Perspective Biosystems). The instrument was operated in the linear configuration, with an acceleration of 20 kV and 80 ns delay. External calibration using oligosaccharide standards was used for mass assignment of the ions. The spectra from 200 laser shots were summed to obtain the final spectrum.
  • the CD3-FITC and CD 19-PE fluorescence of the blood samples were flowcytometrically analyzed by setting a threshold on CD45-CyChrome. B cell-depletion was determined by plotting the ratio of CD19 + B cells to CD3 + T cells.
  • EDTA EDTA
  • 5 ml polystyrene tubes 20 ⁇ l of 10-fold concentrated anti-CD20 antibody samples (1-5000 ng/ml final concentration) or PBS only were added, and the tubes were incubated at 4°C for 30min. Subsequently, samples were washed twice with FACS buffer and pelleted at 300 x g for 3min. Supernatant was aspirated off and cells were taken up in 100 ⁇ l FACS buffer. Next, 1 ⁇ l anti-Fc-specific F(ab')2-FITC fragments (Jackson Immuno Research Laboratories, USA) was added and the tubes were incubated at 4°C for 30min.
  • the high homology antibody acceptor framework search was performed by aligning the mouse B-IyI protein sequence to a collection of human germ-line sequences and picking that human sequence that showed the highest sequence identity.
  • sequence VH1_1O locus 1-e, Ace. No. DP-88
  • IGKV2-40 Ace. No X59314 sequence from the MGT database was chosen to be the framework acceptor for the light chain.
  • CDRs complementary dete ⁇ nining regions
  • the framework 4 region is not part of the variable region of the germ line V gene, the alignment for that position was done individually.
  • the JH4 region was chosen for the heavy chain, and the JK4 region was chosen for the light chain.
  • Molecular modelling of the designed immunoglobulin domain revealed one spot potentially requiring the murine amino acid residues instead of the human ones outside of the CDR. Reintroducing murine amino acid residues into the human framework would generate the so-called back mutations.
  • the human acceptor amino acid residue at Kabat position 27 was back mutated to a tyrosine residue.
  • Humanized antibody variants were designed that either included or omitted the back mutations.
  • the humanized antibody light chain did not require any back mutations.
  • Those critical residues comprise residues 24, 71, and 94 (Kabat numbering), and also those residues at position 27, 28, and 30 (Kabat numbering), which lie outside of the CDRl definition by Kabat, but often are involved in antigen binding.
  • the IMGT sequence IGHV3-15 (Ace No X92216) was chosen as a suitable one. After having designed the protein sequences, DNA sequences encoding these proteins were synthesized as detailed below. Using this approach no back mutations were required either for the light or heavy chain, in order to retain good levels of antigen binding.
  • oligonucleotides are designed from the genes of interest, such, that a series of oligonucleotides is derived from the coding strand, and one other series is from the non-coding strand.
  • the 3' and 5' ends of each oligonucleotide always show complementary sequences to two primers derived from the opposite strand.
  • the newly formed 3 ' end of one primer then anneals with the next primer of the opposite strand, and extending its sequence further under conditions suitable for template dependant DNA chain elongation.
  • the final product was cloned into a conventional vector for propagation in E. coli.
  • Human heavy and light chain leader sequences (for secretion) were added upstream of the above variable region sequences and these were then joined upstream of human IgGl kappa constant heavy and light chain sequences, respectively, using standard molecular biology techniques.
  • the resulting full antibody heavy and light chain DNA sequences were subcloned into mammalian expression vectors (one for the light chain and one for the heavy chain) under the control of the MPSV promoter and upstream of a synthetic polyA site, each vector carrying an EBV OriP sequence, as described in Example 1 above.
  • Antibodies were produced as described in Example 1 above, namely by co- transfecting HEK293-EBNA with the mammalian antibody heavy and light chain expression vectors, harvesting the conditioned culture medium 5 to 7 days post- transfection, and purifying the secreted antibodies by Protein A affinity chromatography, followed by cation exchange chromatography and a final size exclusion chromatographic step to isolate pure monomeric IgGl antibodies.
  • the antibodies were formulated in a 25 mM potassium phosphate, 125 mM sodium chloride, 100 mM glycine solution of pH 6.7.
  • Glycoengineered variants of the humanized antibody variants were produced by co-transfection of the antibody expression vectors together with a GnT-III glycosyltransferase expression vectors, or together with a GnT-III expression vector plus a Golgi mannosidase II expression vector, as described for the chimeric antibody in Example 1 above.
  • Glycoengineered antibodies were purified and formulated as described above for the non-glycoengineered antibodies.
  • the oligosaccharides attached to the Fc region of the antibodies was analysed by MALDI/TOF-MS as described below.
  • sDHB matrix was prepared by dissolving 2 mg of 2,5-dihydroxybenzoic acid plus 0.1 mg of 5-methoxysalicylic acid in 1 ml of ethanol/10 mM aqueous sodium chloride 1:1 (v/v). The samples were air dried, 0.2 ⁇ l ethanol was applied, and the samples were finally allowed to re-crystallize under air.
  • the MALDI-TOF mass spectrometer used to acquire the mass spectra was a Voyager Elite (Perspective Biosystems). The instrument was operated in the linear configuration, with an acceleration of 2OkV and 80 ns delay. External calibration using oligosaccharide standards was used for mass assignment of the ions. The spectra from 200 laser shots were summed to obtain the final spectrum.
  • Human NK cells were isolated from freshly isolated peripheral blood mononuclear cells (PBMC) applying a negative selection enriching for CDl 6- and CD56-positive cells (MACS system, Miltenyi Biotec GmbH, Bergisch Gladbach/Germany). The purity determined by CD56 expression was between 88-95 %.
  • Freshly isolated NK cells were incubated in PBS without calcium and magnesium ions (3 x 10 5 cells/ml) for 20 minutes at 37°C to remove NK cell- associated IgG. Cells were incubated at 10 6 cells/ml at different concentrations of anti-CD20 antibody (0, 0.1, 0.3, 1, 3, 10 ⁇ g/ml) inPBS, 0.1% BSA.
  • the fluorescence intensity referring to the bound antibody variants was determined for CD56-positive cells on a FACSCalibur (BD Biosciences, Allschwil /Switzerland).
  • CHO cells were transfected by electroporation (280 V, 950 ⁇ F, 0.4 cm) with an expression vector coding for the FcgammaRIIIA-Vall58 ⁇ -chain and the ⁇ -chain.
  • Transfectants were selected by addition of 6 ⁇ g/ml puromycin and stable clones were analyzed by FACS using 10 ⁇ l FITC-conjugated-anti-FcgammaRIII 3G8 monoclonal antibody (BD Biosciences, Allschwil/Switzerland) for 10 6 cells. Binding of IgGl to FcgammaRIIlA-Vall58-expressing CHO cells was performed analogously to the NK cell binding described above.
  • PBMC peripheral blood mononuclear cells
  • the interphase containing the PBMC was collected and washed with PBS (50 ml per cells from two gradients) and harvested by centrifugation at 300 x g for 10 minutes at RT. After resuspension of the pellet with PBS, the PBMC were counted and washed a second time by centrifugation at 200 x g for 10 minutes at RT. The cells were then resuspended in the appropriate medium for the subsequent procedures.
  • PBS 50 ml per cells from two gradients
  • the effector to target ratio used for the ADCC assays was 25:1 and 10:1 for PBMC and NK cells, respectively.
  • the effector cells were prepared in ADVI-V medium at the appropriate concentration in order to add 50 ⁇ l per well of round bottom 96 well plates.
  • Target cells were human B lymphoma cells (e.g., Raji cells) grown in DMEM containing 10% FCS.
  • Target cells were washed in PBS, counted and resuspended in AIM-V at 0.3 million per ml in order to add 30,000 cells in 100 ⁇ l per micro well.
  • Antibodies were diluted in AIM-V, added in 50 ⁇ l to the pre-plated target cells and allowed to bind to the targets for 10 minutes at RT.
  • Vmax values of the color reaction were determined in an ELISA reader at 490 nm for at least 10 min using SOFTmax PRO software (Molecular Devices, Sunnyvale, CA94089, USA).
  • Spontaneous LDH release was measured from wells containing only target and effector cells but no antibodies.
  • Maximal release was determined from wells containing only target cells and 1% Triton X-100. Percentage of specific antibody-mediated killing was calculated as follows: ((x- SR)/(MR - SR)* 100, where x is the mean of Vmax 'at a specific antibody concentration, SR is the mean of Vmax of the spontaneous release and MR is the mean of Vmax of the maximal release. >
  • the assay plates were incubated for 2h at 37°C. Killing of cells was determined by measuring LDH release. Briefly, the plates were centrifuged at 300 x g for 3 min. 50 ⁇ l supernatant per well were transferred to anew 96 well plate and 50 ⁇ l of the assay reagent from the Cytotoxicity Kit (Roche) were added. A kinetic measurement with the ELISA reader determined the Vmax corresponding with LDH concentration in the supernatant. Maximal release was determined by incubating the cells in presence of 1% Trition X-100. Whole blood B-cell depletion assay
  • the apoptotic potency of the antibodies was assayed by incubating the antibody at 10 ⁇ g/r ⁇ l (saturating conditions in respect to antigen binding) with the target cells (at a target cell concentration of 5 x 10 5 cells/ml) overnight (16-24 h). Samples were stained with AnnV-FITC and analyzed by FACS. Assay was done in triplicates.
  • Detection is performed by flow cytometry by following the appearance of apoptotic markers like annexin V and phosphatidy serine. Negative control (no apoptosis induced) does not contain any antibody, but only phosphate buffered saline. Positive control (maximal apoptosis) contains 5 micromolar of the strong apoptosis inducer Camptothecin (CPT).
  • CPT Camptothecin
  • B-HHl, B-HH2, B-HH3, complexed with the humanized B-IyI light chain (BKVl), and the parental, chimeric antibody chB-lyl shows that all antibodies have a similar EC50 value, but the B-HHl construct binds with a lower intensity/stoichiometry than the variants B-HH2 and B-HH3 ( Figure 11).
  • B-HHl can be distinguished from B-HH2 and B-HH3 by its partially human CDRl and CDR2 regions (Kabat definition), as well as the Ala/Thr polymorphism at position 28 (Kabat numbering). This indicates that either position 28, the complete CDRl , and/or the complete CDR2 are important for antibody/antigen interaction.
  • alanine or a functional equivalent thereof e.g., leucine, valine, or threonine ⁇ see, e.g., Morea et ah, Methods 20: 267-279 (2000)
  • arginine seems to be detrimental to antigen binding.
  • BHH2-BKV1, BHL8-BKV1, and BHLIl-BKVl variants show good binding affinity, among the different humanized antibody variants tested, to human CD20 on the surface of human cells. Despite similar EC50 values for antigen binding, these variants differ strongly in their behavior to induce apoptosis in CD20 positive target cells (see Figures 4- 6, 14, 15). Since the original B-IyI antibody showed low induction of apoptosis, the present inventors determined the differences between the parental B-IyI antibody contstruct and the B-HL8 and B- HH2 constructs.
  • B-HLl l having the mutationEl Q
  • B-HL12(G9A, V48M) B-HL13(L1 IV, V48M)
  • B-HL14 V12K, V48M
  • B-HL15 G16S, V48M
  • B-HL17(V48M) B-HL17(V48M).
  • residues at Kabat positions 11 and 12 influenced the apoptotic behavior to the largest extent. These residues do not affect the antigen binding directly, but rather influence the interface between the VH and CHl domains and thus act via a modification of the elbow angle.
  • the B-HL4 construct is derived from the B-HH2 antibody by replacing the FRl of the B-HH2 with that of the human germ line sequence IGHV1-45 (Ace No X92209).
  • This construct shows greatly diminished antigen binding capacity, despite having different amino acids at only four positions within FRl . These residues are located at positions 2, 14, 28 and 30 (Kabat numbering). Of these, position 28 and 30 could be an influential position, since it is part of the Chothia definition of CDRl .
  • positions 28 and 30 are modified compared to the parental B-IyI sequence.
  • B-HLl 3 and B-HL14 derivatives of BHL8
  • BHH8 mixed framework
  • BHH9 mixed framework with one back mutation to examine the effect of S30T
  • B-HH6 M34I derivative of B- HH2
  • Variant BHH4 is another humanized B-IyI variant that does not introduce additional non-human sequences.
  • Variants B-HH5, B-HH6 and B-HH7 are derivatives of the B-HH2 construct with a partially humanized Kabat CDRl region.
  • the humanized B-IyI did not have any significant complement mediated lysis activity and displayed much lower complement mediated lysis activity than the anti-CD20 antibody C2B8 (chimeric IgGl with identical sequence to rituximab).
  • Another important property of the humanized B-IyI antibody was that it was very potent in the homotypic aggregation assay.
  • CD20- ⁇ ositive human cells Daudi cells
  • parallel control incubation of the cells was performed under identical conditions using the anti- CD20 antibody, C2B8. At different time points, including 8 hours and 24 hours of incubation, the cells were inspected visually using a microscope.
  • the humanized B-IyI antibody led to strong homotypic aggregation, with aggregates being significantly larger that those induced by addition of the C2B8 control antibody.
  • the antibody being anti-CD20 type ⁇ , it induced higher levels of apoptosis when CD20-positive human cells were incubated with the humanized B-IyI antibody, relative to a control under identical conditions using the C2B8 chimeric IgGl antibody with identical sequence to rituximab.
  • Glycoengineered variants of the humanized antibodies were produced by co-expression of GnTIII glycosyltransferase, together with the antibody genes, in mammalian cells.
  • the ADCC, Fc receptor-dependent cell killing activities and apoptosis induction were present in this superior activity of the humanized B-IyI antibody variants. Furthermore, in the apoptosis assay, both the glycoengineered andnon-glycoengineered forms of this type II anti-CD20 antibody were potent, with the Fc-engineered variants with increased binding affinity to Fcgamma receptors being even more potent in apoptosis induction than the non-Fc-engineered variant, and with all variants being significantly more potent than the control antibody C2B8.
  • Apoptopsis induction is important since, in vivo, there are locations in the body where the target CD20-positive cells can be found, but where access to FcgammaRIII-positive cells is more difficult than in blood (for example, lymph nodes). In those locations, the induction of apoptosis by the anti- CD20 antibody, itself, can be crucial for good efficacy of the anti-CD20 antibody therapy in humans, both for the treatment of haematological malignancies such as non-Hodgkins lymphomas and B-cell chronic lymphocytic leukaemia, and for the treatment of autoimmune diseases such as rheumatoid arthritis and lupus via a B- cell depletion approach.
  • haematological malignancies such as non-Hodgkins lymphomas and B-cell chronic lymphocytic leukaemia
  • autoimmune diseases such as rheumatoid arthritis and lupus via a B- cell depletion approach.
  • the increased binding affinity to FcgammaRIII and higher ADCC of the humanized, Fc-engineered type II anti-CD20 antibody can also be a very important attribute for such therapies.
  • the reduced or negligible complement mediated lysis activity of this type ⁇ anti-CD20 antibody, including humanized and Fc-engineered variants can also be important, since higher complement activation by anti-CD20 antibodies has been correlated with increased, undesirable side-effects.
  • BHH2-A (VIlL) (SEQ ID NO: 124), BHH2-B (K12V) (SEQ ID NO: 125), BHH2-C (A9G) (SEQ ID NO: 126), BHH2-D (ElOG) (SEQ ID NO: 127), BHH2-E (Tl 101) (SEQ ID NO: 128), and BHH2-F (Sl 121) (SEQ ID NO: 129).
  • BHH2-A VIlL
  • BHH2-B K12V
  • BHH2-C A9G
  • BHH2-D ElOG
  • BHH2-E Tl 101
  • BHH2-F Sl 121
  • B-IyI light chain (BKVl) was also examined through the generation of five variants: BKV-10 (P40A) (SEQ ID NO:130), BKV-Il (A80P) (SEQ ED NO:131), BKV-12 (V83F) (SEQ ID NO:132), BKV-13 (E105A) (SEQ ID NO:133), andBKV-14 (Il 06A) (SEQ ID NO: 134). Constructs BKV-Il, BKV- 12, BKV-13, and BKV-14 were tested for binding to target antigen (CD20) by methods described herein above, and it was determined that all four retained binding activity.
  • target antigen CD20

Abstract

The present invention relates to modified antigen binding molecules (ABMs). In particular embodiments, the present invention relates to recombinant monoclonal antibodies or fragments, including chimeric, primatized or humanized antibodies or fragments, having altered ability to mediate cell signaling activity by a target antigen, and/or altered ability to mediate cross-linking of one or more target antigens. In addition, the present invention relates to nucleic acid molecules encoding such modfied ABMs, and vectors and host cells comprising such nucleic acid molecules. The invention further relates to methods for producing the modified ABMs of the invention, and to methods of using these modified ABMs in treatment of disease. In addition, the present invention relates to modified ABMs with modified glycosylation having improved therapeutic properties, including antibodies with increased Fc receptor binding and increased effector function.

Description

MODIFIED ANTIGEN BINDING MOLECULES WITH ALTERED CELL SIGNALING ACTIVITY
BACKGROUND OF THE INVENTION
Field of the Invention
[0001] The present invention relates to antigen binding molecules (ABMs). In particular embodiments, the present invention relates to recombinant monoclonal antibodies or fragments, including chimeric, primatized or humanized antibodies or fragments, having altered ability to mediate cell signaling activity by a target antigen, and/or altered ability to mediate cross-linking of one or more target antigens. In addition, the present invention relates to nucleic acid molecules encoding such ABMs, and vectors and host cells comprising such nucleic acid- molecules. The invention further relates to methods for producing the ABMs of the invention, and to methods of using these ABMs in treatment of disease. In addition, the present invention relates to ABMs with modified glycosylation having improved therapeutic properties, including antibodies with increased Fc receptor binding and increased effector function.
Background Art
[0002] Antibodies, also called immunoglobulins, have a basic structure comprising four polypeptide chains: two identical heavy (H) chains paired with two identical light (L) chains. Each heavy and light chain comprises a variable region (VH and VL, respectively) and a constant region (CH and CL, respectively). The CH region has 3 domains (CHl, CH2, and CH3), while the smaller CL region has only one domain (simply refered to as CL). Each VH and VL region comprises 3 complementarity determinhig regions (CDRs) flanked by 4 framework regions in the following order: FR1-CDR1-FR2-CDR2-FR3- CDR3-FR4. The CDRs are the most variable part of the of the V region, and determine the antigen specificity of the antibody. Together, a paired VH and VL form the antigen binding site, and bivalent antibodies have two such antigen binding sites. It should be noted that this basic antibody structure can be modified in various ways (e.g., by generating fragments of the structure) while still retaining or even improving desired functions and/or antigen binding activity.
[0003] The interface between the VH and CHl domains comprises conserved amino acids. This area of contact can be described as a "molecular ball-and- socket joint." This joint determines the "elbow motion" and also the so called "elbow angle" of the VH and VL regions with respect to the CHl and CL regions, and prevents a rigid contact from forming between the V and C regions (Lesk and „ Chothia, Λføωre (1988) 335(8): 188-190)). The socket of the ball-and-socket joint is formed by amino acid residues in the VH framework region, specifically those at positions 11, 110, and 112 (according to the numbering system of Kabat et al.,
(1987) Sequences of Proteins of Immunological Interest, 4th ed. (Public Health Services, NIH, Washington, DC)). (See Lesk and Chothia, Nature (1988) 335(8): 188-190.) The "ball" of this ball-and-socket joint is found in the CHl domain, and is formed mainly by the two amino acids at positions 148 and 149 (See Landolfi et al, J. Immunol. (2001) 166:1748-1754; Lesk and Chothia, Nature (1988) 335(8):188-190) (wherein the CHl residues forming the "ball" are numbered 149 and 150, respectively)). Differences in the amino acids at these positions can dictate the elbow angle that is formed between the V and C regions, and therefore the orientation of the VH-VL dimer (see Lesk and Chothia, Nature
(1988) 335(8): 188-190). The amino acid residues that occupy these VH positions are highly conserved across immunoglobulin sequences (see e.g., Lesk and Chothia, Nature (1988) 335(8):188-190). AU residues involved in this joint (e.g., positions 11, 110, 112, 148, and 149), are located in the framework regions (e.g.,
' residues 11, 110, and 112) or the constant domain (e.g., 148 and 149 (according to Landolfi et al.; positions 149 and 150 according to Lesk and Chothia), and do not appear to be directly involved in antigen binding. Landolfi et al, J. Immunol. (2001) 166:1748-1754.
[0004] In addition to mediating effector functions such as antibody dependent cell-mediated cytotoxicity (ADCC) and complement dependent cytotoxicity (CDC), monoclonal antibodies can modulate cellular functions by inducing or inhibiting cell signaling pathways. For example, monoclonal antibodies have been shown to mediate antigen cross-linking, activate death receptors (e.g., by facilitating oligomerization of receptors or mimicking ligand binding), and blocking of ligand-mediated cell signaling in cell growth differentiation, and/or proliferation pathways (see, e.g., Ludwig et ah, Oncogene (2003) 22: 9097- 9106).
[0005] Apoptosis, or programmed cell death, can be triggered by several different mechanisms. For example, the activation of signaling pathways through cell membrane-bound "death receptors," e.g., members of the tumor necrosis factor receptor (TNFR) superfamily, can lead to induction of apoptosis. Likewise, dimerization or cross-linking of surface antigen, e.g., CD20, can also induce apoptosis (see, e.g., Ludwig et al, Oncogene (2003) 22: 9097-9106).
[0006] There remains a need for enhanced therapeutic approaches targeting antigens associated with cell signaling, including, but not limited to, the induction of apoptosis, for the treatment of disease in primates, including, but not limited to, humans.
BRIEF SUMMARY OF THE INVENTION
[0007] Recognizing the tremendous therapeutic potential of modified antigen binding molecules (ABMs) that have altered ability to mediate cell signaling activity by a target antigen, and/or altered ability to mediate cross-linking of one or more target antigens, the present inventors developed such ABMs, as well as a method for producing such ABMs. Inter alia, this method involves producing recombinant, chimeric antibodies or chimeric fragments thereof. The efficacy of these modified ABMs is further enhanced by engineering the glycosylation profile of the antibody Fc region.
[0008] Accordingly, in one aspect, the invention is directed to a modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein said substitution results in altered cell signaling activity of a target antigen when said modified antigen binding molecule is complexed with said target antigen. In a particular embodiment, the altered cell signaling activity is apoptosis. hi one embodiment, the modified antigen binding molecule has an increased ability to induce apoptosis. In another embodiment, the modified antigen binding molecule has a reduced ability to induce apoptosis.
[0009] In another aspect, the invention is directed to a modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of aparent antigen binding molecule, wherein saidmodified antigen binding molecule has altered ability to mediate cross-linking of one or more target antigens as a result of said substitution.
[0010] In one embodiment, the modified antigen binding molecule of the present invention comprises a substitution in FRl of the heavy chain variable region. In another embodiment, the substitution comprises a replacement selected from the group consisting of at least 2, at least 3, or at least 4 amino acids.
[0011] In one embodiment, the substitution comprises areplacement of the entire
FRl of the heavy chain variable region. In a further embodiment, the entire FRl" is replaced by a germline VH FRl . In particular embodiments, the germline VH FRl comprises an amino acid sequence at Kabat positions 8 to 13 selected from the group consisting of SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO: 65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO.73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, SEQ ID NO:101, SEQ ID NO: 102,' SEQ ID NO:103, SEQ ID NO:104, and SEQ ID NO:105.
[0012] In one embodiment, the modified ABM comprises a substitution in FRl of the heavy chain variable region which comprises a replacement of an amino acid residue at one or more of Kabat positions 8, 9, 10, 11, 12, or 13.
[0013] In a particular embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 8. In a more specific embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 8 with an amino acid residue selected from the group consisting of arginine, and glycine.
[0014] In another particular embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 9. In a more specific embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 9 with an amino acid residue selected from the group consisting of alanine, proline, glycine, serine, and histidine.
[0015] In one particular embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 10. In a more specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 10 with an amino acid residue selected from the group consisting of glutamate, threonine, glycine, alanine, and valine.
[0016] In another particular embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 11. In specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 11 with any amino acid but leucine. In another specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 11 with a nonpolar amino acid. In another specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 11 with an amino acid residue selected from the group consisting of valine, leucine, isoleucine, serine, and phenylalanine. In a particular embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 11 with a leucine.
[0017] In another particular embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 12. In a specific embodiment, the substitution comprises areplacement of the amino acid residue at Kabat position 12 with an amino acid residue selected from the group consisting of lysine, valine, leucine, and isoleucine.
[0018] In another particular embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residues at Kabat positions 11 and 12. In a specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 11 with a valine and at Kabat position 12 with a lysine; a replacement of the amino acid residue at Kabat position 11 with a leucine and at Kabat position 12 with a valine; a replacement of the amino acid residue at Kabat position 11 with a valine and at Kabat position 12 with an isoleucine; or a replacement of the amino acid residue at Kabat position 11 with a valine and at Kabat position 12 with a valine.
[0019] In another particular embodiment, the substitution in FRl of the heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 13. In a specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 13 with an amino acid residue selected from the group consisting of lysine, arginine, glutamine and glutamate.
[0020] In another aspect of the present invention, the substitution in the ABM comprises replacement of at least one amino acid residue in FR4 of the heavy chain variable region. In a particular embodiment, the substitution in FR4 of the heavy chain variable region comprises a replacement of an amino acid residue at one or more of Kabat positions 110 or 112.
[0021] In a particular embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 110 with an amino acid selected from, the group consisting of leucine, isoleucine, threonine or serine. In a more specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 110 with an isoleucine.
[0022] In another embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 112 with an amino acid selected from the group consisting of valine, leucine, isoleucine, or threonine. In a more specific embodiment, the substitution comprises a replacement of the amino acid residue at Kabat position 112 with an isoleucine.
[0023] In one aspect, the present invention is further directed to a modified antigen binding molecule comprising a CHl domain comprising at least one amino acid residue substitution as compared to the CHl domain of a parent polypeptide, wherein the substitution results in altered cell signaling activity of a target antigen when the modified antigen binding molecule is complexed with the target antigen.
[0024] In another aspect, the present invention is further directed to a modified antigen binding molecule comprising a CHl domain comprising at least one amino acid residue substitution as compared to the CHl domain of a parent polypeptide, wherein the antigen binding molecule has altered ability to mediate cross-linking of one or more target antigens as a result of the substitution. [0025] In a particular embodiment, the substitution in CHl comprises a replacement of an amino acid residue at one or more of positions 148, 149 or 150. In a more specific embodiment, the substitution comprises a replacement of the amino acid residue position 149 with a leucine. In another embodiment, the substitution comprises a replacement of the entire CHl domain. In another embodiment, the substitution comprises a replacement of an IgG CHl domain i with an IgM CHl domain.
[0026] In another aspect, the invention is directed to a modified antigen binding molecule comprising at least one amino acid substitution, wherein said substitution comprises a replacement of an amino acid residue in the light chain in the region of the interface between the variable and constant regions, wherein the substitution results in altered cell signaling activity of a target antigen binding molecule when said modified antigen binding molecule is complexed with said target antigen.
[0027] In another aspect, the invention is directed to a modified antigen binding molecule comprising at least one amino acid substitution, wherein said substitution comprises a replacement of an amino acid residue in the light chain in the region of the interface between the variable and constant regions, wherein said modified antigen binding molecule has altered ability to mediate cross- linking of one or more target antigens as a result of said substitution.
[0028] In a particular embodiment, the substitution in the light chain variable region of the ABM comprises a replacement of an amino acid at one or more of Kabat positions 10, 12, 39, 40, 41, 80, 81, 83, 84, 103, 105, 106, and 108. In a particular embodiment, the substitution in the light chain variable region of the ABM comprises a replacement of an amino acid residue at one or more of Kabat positions 40, 80, 83, 105, or 106.
[0029] In another particular embodiment, the substitution in the light chain of the
ABM comprises a replacement of an amino acid residue at one or more of Kabat positions 40, 80, 83, 105, or 106 with a non-polar amino acid.
[0030] In another particular embodiment, the substitution in the light chain of the
ABM comprises a replacement of an amino acid residue at Kabat position 40 with an alanine. [0031] In another particular embodiment, the substitution in the light chain of the
ABM comprises a replacement of an amino acid residue at Kabat position 80 with a proline.
[0032] In another particular embodiment, the substitution in the light chain of the
ABM comprises a replacement of an amino acid residue at Kabat position 83 with a phenylalanine.
[0033] In another particular embodiment, the substitution in the light chain of the
ABM comprises a replacement of an amino acid residue at Kabat position 105 with an alanine.
[0034] In another particular embodiment, the substitution in the light chain of the
ABM comprises a replacement of an amino acid residue at Kabat position 106 with an alanine. In a more particular embodiment, the substitution in the light chain of the ABM comprises a replacement of an amino acid residue at Kabat position 106, wherein the antigen binding molecule is reduced in its ability to induce apoptosis.
[0035] In some embodiments, the substitutions of the present invention comprise a combination of any of the amino acid residue replacements in the heavy and/or light chain variable and/or constant regions as described herein.
[0036] In one aspect, the amino acid substitution(s) in the modified ABMs of the present invention result in altered cell signaling activity of a target antigen when the modified ABM is complexed with the target antigen.
[0037] In one aspect of the invention, the altered cell signaling activity is increased agonist activity. In one embodiment, the increased agonist activity is selected from the group consisting induction of apoptosis and induction of cell differentiation.
[0038] In another aspect of the invention, the altered cell signaling activity is increased antagonist activity. In one embodiment, the antagonist activity is blockade of a cell signaling pathway selected from the group consisting of cell survival, cell growth, cell proliferation, and angiogenesis.
[0039] In a further aspect, the modified antigen binding molecule of the present invention binds specifically to human CD20. In another aspect, the modified antigen binding molecule binds specifically to a member of the human TNF receptor superfamily. In a particular embodiment, the TNF receptor superfamily is selected from the group consisting of TNFRl, CD95, TRAILRl, TRAILR2, EDAR, and p75NGFR.
[0040] In another aspect of the invention, the modified antigen binding molecule binds specifically to a receptor tyrosine kinase. In a particular embodiment, the receptor tyrosine kinase is selected from the group consisting of HERl (EGFRl), HER2/neu, HER3, HER4, IGF-IR, FGFR5 PDGFR, VEGFRl, VEGFR2, and VEGFR3. In a more specific embodiment, the receptor tyrosine kinase is HERl (EGFRl).
[0041] In another aspect, the present invention is further directed to a modified
ABM that can be selected from, but is not limited to, the group consisting of a whole antibody, an Fab fragment or a fusion protein thereof, an F(ab')2 fragment or a fusion protein thereof, a minibody, a diabody, a triabody, and a tetrabody. In a particular embodiment, the modified ABM is chimeric or fully human. In a more particular embodiment, the chimeric modified ABM is humanized. In another particular embodiment, the modified ABM is multispecific. In a more particular embodiment, the modified ABM is bispecific.
[0042] In another aspect, the parent antigen binding molecule according to the present invention comprises a heavy chain variable region selected from the group consisting of SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, and SEQ ID NO:62.
[0043] In another aspect, the parent antigen binding molecule according to the present invention comprises a light chain selected from the group consisting of SEQ ID NO: 48, SEQ ID NO:130, SEQ ID NO:131, SEQ ID NO:132, SEQ ID NO: 133, and SEQ ID NO: 134.
[0044] In a further aspect, the present invention is also directed to a modified
ABM further comprising a human Fc region. According to one embodiment, the Fc region of the modified ABM has been modified to have altered oligosaccharides. In a more specific embodiment, the Fc region has been modified to have a decreased proportion of fucose residues compared to a non- modified Fc region. In another specific embodiment, the Fc region has an increased proportion of bisected oligosaccharides compared to a non-modified Fc region. In another specific embodiment, the modified oligosaccharides are bisected complex. In another specific embodiment, the modified oligosaccharides have an increased proportion of bisected, nonfucosylated oligosaccharides in the Fc region compared to a non-modified Fc region. In another specific embodiment, the Fc region has an increased proportion of GIcNAc residues to fucose residues in the modified Fc region compared to a non- modified Fc region. In another specific embodiment, the bisected, nonfαcosylated oligosaccharides are hybrid, hi another specific embodiment, the bisected, nonfucosylated oligosaccharides are complex.
[0045] According to another aspect, the target antigen according to the present invention is a cell surface receptor selected from the group consisting of a membrane transport receptor, a G-protein-linked receptor, and an enzyme-linked receptor. In a particular embodiment, the membrane transport receptor is a channel-linked receptor, hi another particular embodiment, the enzyme-linked receptor is selected from the group consisting of receptor guanylyl cyclases, receptor tyrosine kinases, tyrosine-kinase associated receptors, receptor tyrosine phosphatases, and receptor serine/threonine kinases.
[0046] In another aspect, the invention is related to a pharmaceutical composition comprising the modified ABM of the invention. It is contemplated that the pharmaceutical composition may further comprise a pharmaceutically acceptable carrier, an adjuvant or a combination thereof.
[0047] The present invention is also directed to a method of treating a disease treatable by altered cell signaling activity in a patient, the method comprising administering to the patient a therapeutically effective amount of a pharmaceutical composition comprising a modified ABM according to the invention and a pharmaceutically acceptable carrier.
[0048] hi another aspect, the invention is directed to an isolated polynucleotide encoding a polypeptide comprising a heavy chain or light chain variable region, wherein the heavy chain or light chain variable region comprises at least one amino acid residue substitution in at least one framework region as compared to a parent heavy chain or light chain variable region, and wherein the substitution results in altered cell signaling activity of a target antigen when the polypeptide is complexed with the target antigen.
[0049] In a further aspect, the invention is directed to an isolated polynucleotide encoding a polypeptide comprising a heavy chain or light chain variable region, wherein the heavy chain or light chain variable region comprises at least one amino acid residue substitution in at least one framework region as compared to a parent heavy chain or light chain variable region, and wherein the polypeptide has altered ability to mediate cross-linking of one or more target antigens as a result of the substitution.
[0050] hi one embodiment, a polynucleotide according to the present invention encodes a polypeptide, wherein the polypeptide comprises an antibody heavy chain or light chain, hi another embodiment, a polynucleotide according to the present invention encodes a polypeptide, wherein the polypeptide comprises a fusion protein. The present invention is also directed to polypeptides encoded by the polynucleotides of the present invention
[0051] The present invention is also directed to a vector comprising a polynucleotide according to the invention, and a host cell comprising the vector.
[0052] The invention is further directed to a polynucleotide encoding a polypeptide comprising a heavy chain or light chain variable region which comprises at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein the polypeptide is a modified ABM according to the invention.
[0053] The present invention is also directed to a host cell engineered to express at least one nucleic acid encoding a polypeptide having β(l,4)-N- acetylglucosaminyltransferase III activity in an amount sufficient to modify the oligosaccharides in the Fc region of a polypeptide produced by the host cell, wherein the polypeptide is a modified ABM according to the invention. In one embodiment, the polypeptide having β(l ,4)-N-acetylglucosaminyltransferase ITI activity is a fusion polypeptide, hi a particular embodiment, the fusion polypeptide comprises the catalytic domain of β(l,4)-N- acetylglucosaminyltransf erase III. hi another embodiment the fusion polypeptide further comprises the Golgi localization domain of a heterologous Golgi resident polypeptide. The Golgi localization domain can be selected from, but is not limited to, the group consisting of the localization domain of mannosidase II, the localization domain of β(l ,2)-N-acetylglucosaminyltransferase I, the localization domain of β(l,2)-N-acetylglucosaminyltransferase II, the localization domain of mannosidase I, and the localization domain of αl-6 core fucosyltransferase.
[0054] In another embodiment, the modified ABM comprises a region equivalent to the Fc region of a human IgG. [0055] In a further embodiment, the modified ABM produced by the host cell of the present invention exhibits increased Fc receptor binding affinity and/or increased effector function as a result of the oligosaccharide modification. According to the present invention, the increased effector function is selected from the group consisting of increased Fc-mediated cellular cytotoxicity, increased binding to NK cells, increased binding to macrophages, increased binding to polymorphonuclear cells, increased binding to monocytes, increased direct signaling inducing apoptosis, increased dendritic cell maturation, and increased T cell priming. In one embodiment, the Fc receptor is Fcγ activating receptor. In another embodiment, the Fc receptor is FcγRIIIA receptor.
[0056] The host cell of the present invention may be selected from the group that includes, but is not limited to, a CHO cell, an HEK293-EBNA cell, a BHK cell, a NSO cell, a SP2/0 cell, a YO myeloma cell, a P3X63 mouse myeloma cell, a PER cell, a PER.C6 cell or a hybridoma cell.
[0057] In another aspect, the present invention is directed to a method for producing a modified ABM comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent ABM, wherein the substitution results in altered cell signaling activity of a target antigen when the modified ABM is complexed with the target antigen, the method comprising: (i) culturing the host cell of the present invention under conditions permitting the expression of the polynucleotide; and (ii) recovering the modified ABM from the culture medium.
[0058] In a further aspect, the invention is directed to a method for producing a modified ABM comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein the modified antigen binding molecule has altered ability to mediate cross-linking as a result of the substitution, the method comprising: (i) culturing the host cell of the present invention under conditions permitting the expression of the polynucleotide; and (ii) recovering the modified ABM from the culture medium. [0059] In a further aspect, the invention is directed to a method of altering the ability of an ABM to facilitate formation of complexes comprising the target antigen of the ABM, the method comprising: replacing at least one amino acid residue in at least one heavy chain or light chain variable region framework region of a parent ABM. In one embodiment, the ABM increases induction of apoptosis in a cell expressing the target antigen. In another embodiment, the ABM increases induction of cell differentiation in a cell expressing the target antigen.
[0060] The present invention is also directed to a method of inducing apoptosis in a cell, the method comprising contacting the cell with a modified ABM comprising a heavy chain or light chain variable region which comprises at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent ABM, wherein the modified ABM has increased ability to induce apoptosis compared to the parent polypeptide. In a particular embodiment, the cell is a tumor cell, hi one embodiment, the contacting occurs in vivo.
[0061] In another aspect, the present invention is also directed method of treating a disease or disorder that is treatable by altered cell signaling activity of a target antigen, the method comprising administering to a subject in need thereof a therapeutically effective amount of a modified ABM, wherein the modified ABM comprises a heavy chain or light chain variable region comprising at least one amino acid substitution in at least one framework region of the heavy chain or light chain variable region compared to the heavy chain or light chain variable region of a p'arent ABM, and wherein the substitution results in altered cell signaling activity of a target antigen when the modified ABM is complexed with the target antigen.
[0062] hi a further aspect, the invention is directed to a method of treating a disease or disorder that is treatable by altered ability to mediate cross linking of one or more target antigens, the method comprising administering to a subject in need thereof a therapeutically effective amount of a modified ABM, wherein the modified ABM comprises a heavy chain or light chain variable region comprising at least one amino acid substitution in at least one framework region of the heavy chain or light chain variable region compared to the heavy chain or light chain variable region of a parent ABM, and wherein the modified ABM has altered ability to mediate cross-linking of one or more target antigens as a result of the substitution.
[0063] In a particular embodiment, the modified ABM administered according to the present invention comprises a heavy chain variable region selected from the group consisting of SEQ ID NO:4, SEQ E) NO:36, and SEQ ID NO.38.
[0064] In one aspect, the disease or disorder to be treated with a modified ABM of the present invention is a cell proliferation disorder, hi one embodiment, cell proliferation disorder is cancer. In another aspect, the disease or disorder to be treated with a modified ABM of the present invention is a B cell disorder. In a specific embodiment, the B cell disorder is a B cell lymphoma.
[0065] The present invention is also directed to use of a modified ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer.
[0066] In a particular embodiment, the present invention is also directed to use of a modified ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer, wherein said cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
[0067] In another particular embodiment, the present invention is also directed to use of a modified ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer, wherein said antigen binding molecule is used in a therapeutically effective amount from about 1.0 mg/kg to about 15 mg/kg. hi a further embodiment, the therapeutically effective amount is from about 1.5 mg/kg to about 12 mg/kg. In a further embodiment, the therapeutically effective amount is from about 1.5 mg/kg to about 4.5 mg/kg. In a further embodiment, the therapeutically effective amount is from about 4.5 mg/kg to about 12 mg/kg. hi a further embodiment, the therapeutically effective amount is about 1.5 mg/kg. In a further embodiment, the therapeutically effective amount is about 4.5 mg/kg. hi a further embodiment, the therapeutically effective amount is about 12 mg/kg.
[0068] The present invention is also directed to a method for the treatment or prophylaxis of cancer comprising administering a therapeutically effective amount of a pharmaceutical composition of the invention to a patient in need thereof. In a particular embodiment, the cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
[0069] The present invention is also directed to a method for the treatment or prophylaxis of a precancerous condition or lesion comprising administering a therapeutically effective amount of the pharmaceutical composition of claim 85 or 158 to a patient in need thereof. In a particular embodiment, the precancerous condition or lesion is selected from the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
[0070] The present invention is also directed to a modified antigen binding molecule of the present invention for use in the treatment or prophylaxis of cancer. In a particular embodiment, the cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
[0071] The present invention is also directed to a modified antigen binding molecule of the present invention for use in the treatment or prophylaxis of a precancerous condition or lesion. In a particular embodiment, the precancerous condition or lesion is selected from the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
[0072] The present invention is also directed to a modified antigen binding molecule according to the present invention for use in therapy of a disorder that is related to altered cell signaling activity and/or altered cross-linking of one or more target antigens. BRIEF DESCRIPTION OF THE FIGURES
[0073] FIG 1. Amino acid sequence alignment of various anti-CD20 antibody heavy chain variable region constructs. The amino acid sequence of the variable chain heavy region of monoclonal antibody 1F5 is used as the reference sequence. Differences in amino acids from 1F5 are shaded.
[0074] FIG 2. Binding of different humanized anti-CD20 antibodies to Raji
B-cells. The parental (chimeric) B-IyI is compared to those two humanized heavy chain variants that were identified to induce strong apoptosis (BHH2 and BHH6), as well as those derivatives of the (humanized, nonapoptotic) B- HL8 variant that were hypothesized to restore this effect (B-HLl 1 to 17). All humanized heavy chain variants were paired with the same BKVl humanized light chain variant.
[0075] FIG 3. Binding of rituximab (O) and chB-lyl (Δ) to CD20 on Raji B- lymphoma cells.
[0076] FIG 4. Comparison of antibody-dependent apoptosis by three anti-CD20 antibodies. chB-lyl wt represents a chimeric B-IyI antibody construct having a murine variable region and a human constant region. BHH2-BKV1 represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from VHl class human germline V genes for the heavy chain and paired with the BKVl humanized B-IyI light chain. BHL8-BKV1 wt represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from two different human germline V genes and paired with the BKVl humanized B-IyI light chain.
[0077] FIG 5. Comparison of antibody-dependent apoptosis by five humanized variants of the B-IyI anti-CD20 antibody. BHH2-BKV1 represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from VHl class for the heavy chain (BHH2) and paired with the BKVl humanized B-IyI light chain. BHL8-BKVlwt represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from two different human germline V genes and paired with the BKVl humanized B-IyI light chain. BHL14-BKV1 represents a derivative of BHL8, with a valine to lysine substitution at Kabat position 12 and a valine to methionine substitution at Kabat position 48 of the heavy chain variable region, and paired with the BKVl light chain construct. BHL15-BKV1 Wl is also derived from BHL8, with a glycine to serine substitution at Kabat position 16, and a valine to methionine substitution at Kabat position 48 of the heavy chain variable region and paired with the BKVl light chain construct. BHLl 6-BKV1 Wl is derived from BHL8, with a leucine to valine substitution at Kabat position 20, and a valine to methionine substitution at Kabat position 48 of the heavy chain variable region and paired with the BKVl light chain construct. BHL17-BKV1 Wl is derived from BHL8, with a valine to methionine substitution at Kabat position 48 of the heavy chain variable region and paired with the BKVl light chain construct.
[0078] FIG 6. Comparison of antibody-dependent apoptosis in Z-138 cells by
C2B8 anti-CD20 monoclonal antibody and two humanized variants of B-IyI antibody, BHH2-BKV1 and BHL13-BKV1. BHH2-BKV1 represents a humanized variant comprising murine B-IyI CDRs and human framework regions derived from VHl class human germline V genes for the heavy chain and paired with the BKVl humanized B-IyI light chain. BHL13-BKV1 is derived from BHL8 (see Figure 5, above), with a leucine to valine substitution at Kabat position 11 and a valine to methionine substitution at Kabat position 48 in the heavy chain variable region, and paired with a BKVl light chain.
[0079] FIG 7. B-CeIl depletion by rituximab (0) and chB-lyl (■) in whole blood of the three different classes of FcγRIIIa-158V/F genotype: (A) whole blood from a F/F donor, homozygous for the lower affinity receptor; (B) whole blood from a F/V donor, heterozygous for the affinity receptor; and (C) whole blood from a V/V donor, homozygous for the higher affinity receptor.
[0080] FIG 8. MALDI-TOF profile of a glycoengineered, chimeric B-IyI antibody. (A) Table detailing the percentages of specific peaks; (B) Spectrum for glycoengineered chimeric B-IyI ; (C) Spectrum for glycoengineered chimeric B- LyI treated with Endo-H.
[0081] FIG 9. Binding of different humanized anti-CD20 antibodies to Raji B- cells. The differences between the B-HH2 construct and the B-HL8 and B-HLl 1 constructs are located in the framework 1 and 2 regions with all three CDRs being identical. B-HL8 and B-HLIl have their FRl andFR2 sequences derived from the human VH3 class, whereas the complete B-HH2 framework is human VHl derived. B-HLIl is a derivative of B-HL8 with the single mutation GlulGln, with GIn being the amino acid residue in the B-HH2 construct. This means that the Glul Gm exchange does not alter binding affinity or intensity. The other differences between B-HH2 and B-HL8 are 14 FR residues, from which one or more will influence the antigen binding behavior of this antibody.
[0082] FIG 10. Binding of the humanized anti-CD20 antibody BHL4-BKV1 on
Raji target cells. The B-HL4 construct is derived from the B-HH2 antibody by replacing the FRl of the B-HH2 with that of the human germ line sequence IGHVl -45 (Ace No X92209). This construct shows greatly diminished antigen binding capacity, despite having different amino acids at only four positions within FRl . These residues are located at positions 2, 14, 28 and 30 according to Kabat numbering. Of these, positions 28, and 30 appear to be influential positions, since they are part of the Chothia definition of CDRl.
[0083] FIG 11. Comparison of the binding behavior between B-HH 1 , B-HH2,
B-HH3 (all paired with the BKVl humanized B-IyI light chain), and the parental antibody B-IyI . The data show that all Abs show a similar EC50 value, but the B-HHl construct binds with a lower intensity/stoichiometry than the the variants B-HH2 and B-HH3. B-HHl can be distinguished from B-HH2 and B-HH3 by its partially human CDRl and CDR2 regions (Kabat definition), as well as the Ala/Thr polymorphism at position 28 (Kabat numbering). This indicates that either position 28, the complete CDRl, and/or the complete CDR2 is important for antibody/antigen interaction.
[0084] FIG 12. Comparison of the binding behavior between B-HLl, B-HHl, and the B-IyI parental antibody. The data showed absence of any binding activity in the B-HLl construct, and about half of the binding intensity /stoichiometry of B-HHl compared to B-IyI. Both B-HLl, as well as B-HHl, are designed based on acceptor frameworks derived from the human VHl class. Among other differences, position 71 (Kabat numbering) of the B-HLl construct is a striking difference, indicating its putative importance for antigen binding.
[0085] FIG 13. Comparison of the binding behavior between the anti-CD20 antibody heavy chain construct B-HL2, and B-HL3 to its antigen. In both cases the murine VL sequence was combined with the humanized heavy chains The data showed that the B-HL2 and B-HL3 constructs do not display CD-20 binding activity.
[0086] FIG 14. Apoptotic effect of anti-CD20 antibodies on Z-138 MCL cells. [0087] FIG 15. Apoptosis by anti-CD20 antibodies. Assay details: 5 x 105 cells/well were seeded in 24- well plates (5 x 105 cells/ml) in culture medium. 10 μg/ml final concentration of the respective antibody, PBS for the negative control or 5mM Camptothecin (CPT) positive control were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate. (*): Signal for PBS alone subtracted (PBS alone gave 8% and 2% AnnV+ for PR-I and Z-138 cells, respectively). Antibodies used were: C2B8 (chimeric, non-glycoengineered); BHH2-BKV1 (humanized, non-glycoengineered). Note: this assay does not involve any additional effector cells, just targets plus antibody or controls.
[0088] FIG 16. Target-cell killing by anti-CD20 antibodies with immune effector cells. Assay details: B-cell depletion in normal whole blood was determined by overnight incubation and analysis for CD19+/CD3+ by FACS. ADCC was determined using PBMCs as effectors with a 4 h incubation and a 25:1 effector:target ratio. Target-killing was measured by Calcein-retention relative to detergent-lysis (100%) and to lysis without antibody (0%). Antibodies used were: C2B8 (chimeric, non-glycoengineered form); BHH2-BKVl-wt (humanized, non-glycoengineered form of BHH2-BKV1); BHH2-BKV1-GE (humanized, glycoengineered form of BHH2-BKV1).
[0089] FIG 17. MALDI/TOF-MS profile of PNGaseF-released Fc- oligosaccharides of unmodified, nonglycoengineeredBHH2-BKVl humanized IgGl B-IyI anti-human CD20 antibody.
[0090] FIG 18. MALDI/TOF-MS profile of PNGaseF-released Fc- oligosaccharides of glycoengineered BHH2-BKVlgl humanized IgGl B-IyI anti-human CD20 antibody. Glycoengineering was performed by co-expression in host cells of antibody genes and a gene encoding an enzyme with β-l,4-N- acetylglucosaminyltransferase III (GnT-IH) catalytic activity.
[0091] FIG 19. MALDI/TOF-MS profile of PNGaseF-released Fc- oligosaccharides of glycoengineered BHH2-BKVlg2 humanized IgGl B-IyI anti-human CD20 antibody. Glycoengineering was performed by co-expression in host cells of antibody genes and genes encoding an enzyme with β-l,4-N- acetylglucosaminyltransferase in (GnT-III) catalytic activity and encoding an enzyme with Golgi α-mannosidase II catalytic activity. [0092] FIG 20. Binding of non-glycoengineered and glycoengineered (g2 version; see Figures 17 - 19 for glycosylation profiles) antibodies to human FcgammaRIIIa receptor displayed on the surface of CHO cells expressing recombinant CD 16.
[0093] FIG 21. Apoptotic effect of non-Fc engineered and Fc-engineered anti-
CD20 antibodies on Z-138 MCL cells. Assay details: 5 x 105 cells/well were seeded in 24-well plates (5 x 105 cells/ml) in culture medium. 10 μg/ml final concentration of the respective antibody, or PBS for the negative control, were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate. Antibodies used were: C2B8 = rituximab (chimeric, non-glycoengineered form); BHH2-BKV1 (humanized, non-glycoengineered-see Figure 17 - 19 for glycosylation profile); BHH2-BKVlgl (humanized, glycoengineered); BHH2-BKVlg2 (humanized, glycoengineered). Note: this assay does not involve any additional effector cells, just targets plus antibody or controls. (*): Signal for PBS alone was subtracted.
[0094] FIG 22. Binding of different humanized anti-CD20 antibodies to Raji B- cells. The humanized heavy chain construct BHH2 is compared to its derivatives BHH4 and BHH7. Also shown are variants that address the influence of Kabat positions 28 and 30 (BHH8 and BHH9).
[0095] FIG 23. Effect of single amino-acid exchange on apoptosis by anti-CD20 antibodies on Z-138 MCL cells. Assay details: 5 x 105 cells/well were seeded in 24-well plates (5 x 105 cells/ml) in culture medium. 10 μg/ml final concentration of the respective antibody, or PBS for the negative control (no Ab), were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate. Antibodies used were: C2B8 (chimeric, non-glycoengineered), BHH2 (humanized, non- glycoengineered), BHH2-A (a derivative of BHH2 with a valine to leucine substitution at Kabat position 11), and BHH2-B (a derivative of BHH2 with a lysine to valine substitution at Kabat position 12), the latter three paired with a BKVl light chain. KD of antigen binding remains unchanged by substitution. Note: this assay does not involve any additional effector cells, just targets plus antibody or controls. [0096] FIG 24. Effect of single amino-acid exchange on apoptosis by previously inactive anti-CD20 antibodies on Z-138 MCL cells. Assay details: 5 x 105 cells/well were seeded in 24-well plates (5 x 105 cells/ml) in culture medium. 10 μg/ml final concentration of the respective antibody, or PBS for the negative control, were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate. Antibodies used were: C2B8 (chimeric, non-glycoengineered), BHL8 (humanized, non-glycoengineered), BHLl 3 (a derivative of BHL8 with a leucine to valine substitution at Kabat position 11 and a valine to methionine substitution at Kabat position 48), and BHL14 (a derivative of BHL8 with a valine to lysine substitution at Kabat position 12 and a valine to methionine substitution at Kabat position 48), the latter three paired with a BKVl light chain. Note: this assay does not involve any additional effector cells, just targets plus antibody or controls.
[0097] FIG 25. Effect of single amino-acid exchange within the light chain on apoptosis by anti-CD20 antibodies on Z-138 MCL cells. Assay details: 5 x 105 cells/well were seeded in 24-well plates (5 x 105 cells/ml) in culture medium. 10 μg/ml final concentration of the respective antibody, PBS for the negative control (no Ab)5 or 5mM Camptothecin (CPT) for the positive control were added to the wells. Samples were incubated o/n (16 h), stained with AnnV-FITC and analysed by FACS. Assays were performed in triplicate. Antibodies used were: BHH2-A (a derivative of BHH2 with a valine to leucine substitution at Kabat position 11) paired with a BKVl light chain, BHH6 (a derivative of BHH2 with a methionine to isoleucine substitution at Kabat position 34) paired with a BKVl light chain, and BHH6 paired with a BKV14 light chain (a derivative of BKVl with an isoleucine to alanine substitution at Kabat position 106).
[0098] FIG 26. 3-dimensional depiction of a molecular "ball and socket joint" at the interface between the VH and CHl domains.
DETAILED DESCRIPTION OF THE INVENTION
[0099] Terms are used herein as generally used in the art, unless otherwise defined as follows and herein. [0100] As used herein, the term antigen binding molecule (ABM) refers in its broadest sense to a molecule that specifically binds an antigenic determinant. By "specifically binds" is meant that the binding is selective for the antigen and can be discriminated from unwanted or nonspecific interactions. As used herein, the term modified antigen binding molecule (or modified ABM) is intended to refer to an ABM comprising at least one amino acid residue substitution in the heavy chain variable region and/or CHl region and/or at least one amino acid residue substitution in the light chain variable region and/or CL region.
[0101] As used herein, the term antibody is intended to include whole antibody molecules, including monoclonal, polyclonal and multispecific {e.g., bispecific) antibodies, as well as antibody fragments having the Fc region and retaining binding specificity, and fusion proteins that include a region equivalent to the Fc region of an immunoglobulin and that retain binding specificity. Also encompassed are antibody fragments that retain binding specificity including, but not limited to, VH fragments, VL fragments, Fab fragments, F(ab')2 fragments, scFv fragments, Fv fragments, minibodies, diabodies, triabodies, andtetrabodies {see, e.g., Hudson and Souriau, Nature Med. 9: 129-134 (2003), incorporated herein by reference in its entirety). Also encompassed are humanized, primatized and chimeric antibodies. As used herein, whole antibody refers to an immunoglobulin molecule comprising two heavy chains and two light chains, each of which comprises a variable and constant region.
[0102] As used herein, the term variable region is intended to refer to the N- terminal domain of an immunoglobulin heavy or light chain. According to one embodiment of the present invention, a modified ABM can comprise a functional fragment of a variable region.
[0103] As used herein, the term heavy chain variable region is intended to refer to the N-terminal domain of an immunoglobulin heavy chain. In one example, the heavy chain variable region is defined by Kabat positions 1 to 113 (with possible insertions at particular residues as designated by Kabat et ah, U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest" (1983)). According to one embodiment of the present invention, a modified ABM can comprise a functional fragment of a heavy chain variable region.
[0104] As used herein, the term heavy chain constant region is intended to refer to the C terminal domain of a immunoglobulin heavy chain. There are five naturally-occurring classes of heavy chain constant regions: IgA, IgG, IgE, IgD, and IgM. In one example, the heavy chain constant region comprises a CHl domain, a CH2 domain, and a CH3 domain.
[0105] As used herein, the term CHl region is intended to refer to the domain of the heavy chain of an immunoglobulin that is just C-terminal to the variable region and N-terminal to the hinge region. In an immunoglobulin of the IgG type, for example, CHl is normally defined by Kabat positions 114 to 228.
[0106] As used herein, the term apoptosis is intended to refer to programmed cell death, which is characterized by certain cellular events such as nuclear fragmentation and/or formation of apoptotic bodies by condensation of cytoplasm, plasma membranes and/or organelles.
[0107] As used herein, the term agonist activity is intended to refer to activity of an agent (e.g., an antigen binding molecule) when it interacts with (for example, binds to) a molecule associated with a cell surface and initiates or induces a reaction.
[0108] As used herein, the term antagonist activity is intended to refer to activity of an agent (e.g., an antigen binding molecule) when it interacts with (for example, binds to) a molecule on a cell and prevents initiation or induction of a reaction or discontinues an ongoing reaction.
[0109] As used herein, the terms fusion and chimeric, when used in reference to polypeptides such as ABMs refer to polypeptides comprising amino acid sequences derived from two or more heterologous polypeptides, such as portions of antibodies from different species. For chimeric ABMs, for example, the non- antigen binding components may be derived from a wide variety of species, including primates such as chimpanzees and humans. The constant region of the chimeric ABM is most preferably substantially identical to the constant region of a natural human antibody; the variable region of the chimeric antibody is most preferably derived from a non-human (i.e., donor) antigen binding molecule that specifically binds an antigen of interest. The chimeric ABM may comprise the entire donor variable region; alternatively, the chimeric antibody may comprise a humanized or primatized antibody. Humanized antibodies are a particularly preferred form of fusion or chimeric antibody.
[0110] As used herein, the term humanized is used to refer to an antigen binding molecule derived from a non-human antigen-binding molecule, for example, a murine antibody, that retains or substantially retains the antigen-binding properties of the parent molecule but which is less immunogenic in humans. This may be achieved by various methods including (a) grafting the entire non-human variable domains onto human constant regions to generate chimeric antibodies, (b) grafting only the non-human CDRs onto human framework and constant regions with or without retention of critical framework residues (e.g., those that are important for retaining good antigen binding affinity or antibody functions), or (c) transplanting the entire non-human variable domains, but "cloaking" them with a human-like section by replacement of surface residues . Such methods are disclosed in Jones et al., Morrison et al., Proc. Natl. Acad. Sd., 81:6851-6855 (1984); Morrison and Oi, Adv. Immunol, 44:65-92 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988); Padlan, Molec. Immun., 28:489-498 (1991); Padlan, Molec. Immun., 31(3):169-217 (1994), all of which are incorporated by reference in their entirety herein.
[0111] There are generally 3 complementarity determining regions, or CDRs,
(CDRl, CDR2 and CDR3) in each of the heavy and light chain variable domains of an antibody, which are flanked by four framework subregions (i.e., FRl, FR2, FR3, and FR4) in each of the heavy and light chain variable domains of an antibody: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. A discussion of humanized antibodies can be found, inter alia, in U.S. Patent No. 6,632,927, and in published U.S. Application No. 2003/0175269, both of which are incorporated herein by reference in their entireties.
[0112] Similarly, as used herein, the term primatized is used to refer to an antigen-binding molecule derived from a non-primate antigen-binding molecule, for example, a murine antibody, that retains or substantially retains the antigen- binding properties of the parent molecule but which is less immunogenic in primates.
[0113] In the case where there are two or more definitions of a term which is used and/or accepted within the art, the definition of the term as used herein is intended to include all such meanings unless explicitly stated to the contrary. A specific example is the use of the term "complementarity determining region" ("CDR") to describe the non-contiguous antigen combining sites found within the variable region of both heavy and light chain polypeptides. This particular region has been described by Kabat et al., U.S. Dept. of Health and Human Services, "Sequences of Proteins of Immunological Interest" (1983) and by Chothia et al., J MoI Biol. 196:901-917 (1987), which are incorporated herein by reference, where the definitions include overlapping or subsets of amino acid residues when compared against each other. Nevertheless, application of either definition to refer to a CDR of an antibody or variants thereof is intended to be within the scope of the term as defined and used herein. The appropriate amino acid residues which encompass the CDRs as defined by each of the above cited references are set forth below in Table I as a comparison. The exact residue numbers which encompass a particular CDR will vary depending on the sequence and size of the CDR. Those skilled in the art can routinely determine which residues comprise a particular CDR given the variable region amino acid sequence of the antibody.
TABLE l. CDR Definitions1
Figure imgf000026_0001
'Numbering of all CDR definitions in Table 1 is according to the numbering conventions set forth by Kabat et al. (see below). 211OxAbM" refers to the CDRs as defined by Oxford Molecular's "AbM" antibody modeling software. Kabat et al. also defined a numbering system for variable domain sequences that is applicable to any antibody. One of ordinary skill in the art can unambigously assign this system of "Kabat numbering" to any variable domain sequence, without reliance on any experimental data beyond the sequence itself. As used herein, "Kabat numbering" refers to the numbering system set forth by Kabat et al, U.S. Dept. of Health and Human Services, "Sequence of Proteins of Immunological Interest" (1983). Unless otherwise specified, references to the numbering of specific amino acid residue positions in an ABM are according to the Kabat numbering system. The sequences of the sequence listing are not numbered according to the Kabat numbering system. [0115] As used herein, a polypeptide having "GnTIII activity" refers to polypeptides that are able to catalyze the addition of a N-acetylglucosamine (GIcNAc) residue in β-1-4 linkage to the β-linkedmannoside of the trimannosyl core of N-linked oligosaccharides. This includes fusion polypeptides exhibiting enzymatic activity similar to, but not necessarily identical to, an activity of β(l,4)-N-acetylglucosaminyltransferase III, also known as β-l,4-mannosyl- glycoprotein 4-beta-N-acetylglucosaminyl-transferase (EC 2.4.1.144), according to the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (NC-IUBMB), as measured in a particular biological assay, with or without dose dependency. In the case where dose dependency does exist, it need not be identical to that of GnTIII, but rather substantially similar to the dose-dependence in a given activity as compared to the GnTIH (i.e., the candidate polypeptide will exhibit greater activity or not more than about 25 -fold less and, preferably, not more than about tenfold less activity, and most preferably, not more than about three-fold less activity relative to the GnTIII.)
[0116] As used herein, the term variant (or analog) refers to a polypeptide differing from a specifically recited polypeptide of the invention by amino acid insertions, deletions, and substitutions, created using, e g., recombinant DNA techniques. Variants of the ABMs of the present invention include chimeric, primatized or humanized antigen binding molecules wherein one or several of the amino acid residues are modified by replacement, addition and/or deletion in such manner that does not substantially affect antigen binding affinity. Guidance in determining which amino acid residues may be replaced, added or deleted without abolishing activities of interest, maybe found by comparing the sequence of the particular polypeptide with that of homologous peptides and minimizing the number of amino acid sequence changes made in regions of high homology (conserved regions) or by replacing amino acids with consensus sequence.
[0117] Alternatively, recombinant variants encoding these same or similar polypeptides may be synthesized or selected by making use of the "redundancy" in the genetic code. Various codon substitutions, such as the silent changes which produce various restriction sites, may be introduced to optimize cloning into a plasmid or viral vector or expression in a particular prokaryotic or eukaryotic system. Mutations in the polynucleotide sequence may be reflected in the polypeptide or domains of other peptides added to the polypeptide to modify the properties of any part of the polypeptide, to change characteristics such as ligand- binding affinities, interchain affinities, or degradation/turnover rate.
[0118] As used herein, amino acid residue substitution is intended to refer to replacing one or more amino acids in a reference sequence (e.g., a parent molecule, such as an antigen binding molecule). In one embodiment, amino acid residue substitution may be achieved by, for example, a point mutation in the sequence of a nucleic acid encoding a polypeptide as compared to a parent sequence. In another embodiment, substitution of an amino acid residue maybe achieved by replacing the entire framework region of the parent polypeptide with, for example, a framework region from a germline VH sequence that comprises the desired amino acid at the position to be substituted in reference to the parent.
[0119] "Conservative" amino acid substitutions are those made by replacing one amino acid with another amino acid having similar structural and/or chemical properties, i.e., conservative amino acid replacements, and may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved. For example, nonpolar (hydrophobic) amino acids include glycine, alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; polar neutral amino acids include serine, threonine, cysteine, tyrosine, asparagine, and glutamine; positively charged (basic) amino acids include arginine, lysine, andhistidine; and negatively charged (acidic) amino acids include aspartic acid and glutamic acid. "Insertions" or "deletions" are preferably in the range of about 1 to 20 amino acids, more preferably 1 to 10 amino acids. The variation allowed may be experimentally determined by systematically making insertions, deletions, or substitutions of amino acids in a polypeptide molecule using recombinant DNA techniques and assaying the resulting recombinant variants for activity.
[0120] As used herein, the term parent antigen binding molecule, or parent molecule refers to a polypeptide having aparticular amino acid sequence encoded by a polynucleotide sequence. The sequence of the parent molecule {i.e., the parent sequence) serves as a reference sequence for making amino acid residue substitutions that alter the ability of the resulting molecule (e.g., a modified antigen binding molecule) to induce or block cell signaling activity and/or cross- linking of antigen. Likewise, the activity of a parent molecule serves as the reference when determining whether a substitution has an effect on cell signaling activity and/or cross-linking of antigen, and, where relevant, the extent of that effect. A sequence containing one or more amino acid substitutions in comparison to its parent (e.g., a modified ABM) may in turn serve as a parent sequence for further substitutions.
[0121] As used herein, the term altered cell signaling activity is intended to refer to an increase or decrease in the ability of an ABM to induce or inhibit cell signaling activity of a target antigen.
[0122] As used herein, the term altered cross-linking of one or more target antigens is intended to refer to an increase or decrease in the ability of an ABM to bring into closer proximity to each other, and/or into closer proximity with other membrane-associated molecules, and/or into a more favorable conformation for interaction target antigens that are capable of forming complexes (e.g., through cross-linking of proteins, or oligomerization of membrane-associated receptors) to initiate cell signaling pathways.
[0123] As used herein, cell signaling mechanism or cell signaling activity is intended to refer to the entire signaling (i.e., signal transduction) pathway that leads to a particular cellular event or biological function, as well as any signaling steps along the pathway.
[0124] By a nucleic acid or polynucleotide having a nucleotide sequence at least, for example, 95% "identical" to a reference nucleotide sequence of the present invention, it is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
[0125] As a practical matter, whether any particular nucleic acid molecule or polypeptide is at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence or polypeptide sequence of the present invention can be determined conventionally using known computer programs. A preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brutlag et al, Comp. App. Biosci. <5:237-245 (1990). In a sequence alignment the query and subject sequences are both DNA sequences. An RNA sequence can be compared by converting U's to T's. The result of said global sequence alignment is in percent identity. Preferred parameters used in a FASTDB alignment of DNA sequences to calculate percent identity are: Matrix=Unitary, k-tuple=4, Mismatch Penalty=l, Joining Penaltv=30, Randomization Group Length=0, Cutoff Score=l, Gap Penalty=5, Gap Size Penalty 0.05, Window Size=500 or the length of the subject nucleotide sequence, whichever is shorter.
[0126] If the subject sequence is shorter than the query sequence because of 5' or
3' deletions, not because of internal deletions, a manual correction must be made to the results. This is because the FASTDB program does not account for 5' and 3' truncations of the subject sequence when calculating percent identity. For subject sequences truncated at the 5' or 3' ends, relative to the query sequence, the percent identity is corrected by calculating the number of bases of the query sequence that are 5' and 3' of the subject sequence, which are not matched/aligned, as a percent of the total bases of the query sequence. Whether a nucleotide is matched/aligned is determined by results of the FASTDB sequence alignment. This percentage is then subtracted from the percent identity, calculated by the above FASTDB program using the specified parameters, to arrive at a final percent identity score. This corrected score is what is used for the purposes of the present invention. Only bases outside the 5' and 3' bases of the subject sequence, as displayed by the FASTDB alignment, which are not matched/aligned with the query sequence, are calculated for the purposes of manually adjusting the percent identity score.
[0127] For example, a 90 base subject sequence is aligned to a 100 base query sequence to determine percent identity. The deletions occur at the 5' end of the subject sequence and therefore, the FASTDB alignment does not show a matched/alignment of the first 10 bases at 5' end. The 10 unpaired bases represent 10% of the sequence (number of bases at the 5' and 3' ends not matched/total number of bases in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 bases were perfectly matched the final percent identity would be 90%. In another example, a 90 base subject sequence is compared with a 100 base query sequence. This time the deletions are internal deletions so that there are no bases on the 5' or 3' end of the subject sequence which are not matched/aligned with the query. In this case the percent identity calculated by FASTDB is not manually corrected. Once again, only bases on the 5' and 31 end of the subject sequence which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are to made for the purposes of the present invention.
[0128] By a polypeptide having an amino acid sequence at least, for example,
95% "identical" to a query amino acid sequence of the present invention, it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a query amino acid sequence, up to 5% of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid. These alterations of the reference sequence may occur at the amino or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
[0129] As a practical matter, whether any particular polypeptide is at least 80%,
85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a reference polypeptide can be determined conventionally using known computer programs. A preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program based on the algorithm of Brutlag βt al, Comp. App. Biosci. (5:237-245 (1990). In a sequence alignment the query and subject sequences are either both nucleotide sequences or both amino acid sequences. The result of said global sequence alignment is in percent identity. Preferred parameters used in a FASTDB amino acid alignment are: Matrix=PAM 0, k-tuple=2, Mismatch Penalty=l, Joining Penalty=20, Randomization Group Length=O, Cutoff Score=l, Window Size^sequence length, Gap Penalty=5, Gap Size Penalty=0.05, Window Size=500 or the length of the subject amino acid sequence, whichever is shorter.
[0130] If the subject sequence is shorter than the query sequence due to N- or
C-terminal deletions, not because of internal deletions, a manual correction must be made to the results. This is because the FASTDB program does not account for N- and C-terminal truncations of the subject sequence when calculating global percent identity. For subject sequences truncated at the N- and C-termini, relative to the query sequence, the percent identity is corrected by calculating the number of residues of the query sequence that are N- and C-terminal of the subject sequence, which are not matched/aligned with a corresponding subject residue, as a percent of the total bases of the query sequence. Whether a residue is matched/aligned is determined by results of the FASTDB sequence alignment. This percentage is then subtracted from the percent identity, calculated by the above FASTDB program using the specified parameters, to arrive at a final percent identity score. This final percent identity score is what is used for the purposes of the present invention. Only residues to the N— and C-termini of the subject sequence, which are not matched/aligned with the query sequence, are considered for the purposes of manually adjusting the percent identity score. That is, only query residue positions outside the farthest N- and C-terminal residues of the subject sequence.
[0131] For example, a 90 amino acid residue subject sequence is aligned with a
100 residue query sequence to determine percent identity. The deletion occurs at the N-terminus of the subject sequence and therefore, the FASTDB alignment does not show a matching/alignment of the first 10 residues at the N-terminus. The 10 unpaired residues represent 10% of the sequence (number of residues at the N- and C- termini not matched/total number of residues in the query sequence) so 10% is subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 residues were perfectly matched the final percent identity would be 90%. In another example, a 90 residue subject sequence is compared with a 100 residue query sequence. This time the deletions are internal deletions so there are no residues at the N- or C-termini of the subject sequence which are not matched/aligned with the query. In this case the percent identity calculated by FASTDB is not manually corrected. Once again, only residue positions outside the N- and C-terminal ends of the subject sequence, as displayed in the FASTDB alignment, which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are to be made for the purposes of the present invention.
[0132] As used herein, a nucleic acid that "hybridizes under stringent conditions" to a nucleic acid sequence of the invention, refers to a polynucleotide that hybridizes in an overnight incubation at 42° C in a solution comprising 50% formamide, 5x SSC (750 mM NaCl, 75 mM sodium citrate), 50 mM sodium phosphate (pH 7.6), 5x Denhardt's solution, 10% dextran sulfate, and 20 μg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in O.lx SSC at about 65°C.
[0133] As used herein, the term Fc region is intended to refer to a C-terminal region of an IgG heavy chain. Although the boundaries of the Ec region of an IgG heavy chain might vary slightly, the human IgG heavy chain Fc region is usually defined to stretch from the amino acid residue at position Cys226 to the carboxyl-terminus .
[0134] As used herein, the term region equivalent to the Fc region of an immunoglobulin is intended to include naturally occurring allelic variants of the Fc region of an immunoglobulin as well as variants having alterations which produce substitutions, additions, or deletions but which do not decrease substantially the ability of the immunoglobulin to mediate effector functions (such as antibody dependent cellular cytotoxicity). For example, one or more amino acids can be deleted from the N-terminus or C-terminus of the Fc region of an immunoglobulin without substantial loss of biological function. Such variants can be selected according to general rules known in the art so as to have minimal effect on activity. {See, e.g., Bowie, J. U. et al., Science 247:1306-10 (1990)). In one embodiment, a region equivalent to the Fc region can also form part of a heterologous fusion protein. In some embodiments, a region equivalent to the Fc region also encompasses a corresponding region from another class of immunoglobulin heavy chain {e.g., IgA, IgE, IgD, and IgM).
[0135] As used herein, the term Golgi localization domain refers to the amino acid sequence of a Golgi resident polypeptide which is responsible for anchoring the polypeptide in location within the Golgi complex. Generally, localization domains comprise amino terminal "tails" of an enzyme.
[0136] As used herein, the term effector function refers to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include, but are not limited to, Fc receptor binding affinity, antibody- dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), cytokine secretion, immune-complex-mediated antigen uptake by antigen-presenting cells, down-regulation of cell surface receptors, etc.
[0137] As used herein, the terms engineer, engineered, engineering, glycoengineer, glycoengineered, glycoengineering, zxxά glycosylation engineering axe considered to include any manipulation of the glycosylation pattern of a naturally occurring or recombinant polypeptide, such as an antigen binding molecule (ABM), or fragment thereof. Glycosylation engineering includes metabolic engineering of the glycosylation machinery of a cell, including genetic manipulations of the oligosaccharide synthesis pathways to achieve altered glycosylation of glycoproteins expressed in cells. In one embodiment, the glycosylation engineering is an alteration in glycosyltransferase activity. In a particular embodiment, the engineering results in altered glucosaminyltransferase activity and/or fucosyltransferase activity.
[0138] As used herein, the term host cell covers any kind of cellular system which can be engineered to generate the polypeptides and antigen-binding molecules of the present invention. Host cells include cultured cells, e.g., mammalian cultured cells, such as CHO cells, BHK cells, HEK293 -EBNA cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, yeast cells, insect cells, and plant cells, to name only a few, but also cells comprised within a transgenic animal, transgenic plant or cultured plant or animal tissue. In one embodiment, the host cell is engineered to allow the production of an antigen binding molecule with modified glycoforms. In a preferred embodiment, the antigen binding molecule is an antibody, antibody fragment, or fusion protein. In certain embodiments, the host cells have been further manipulated to express increased levels of one or more polypeptides having GnTIII activity. In other embodiments, the host cells have been engineered to have eliminated, reduced or inhibited core αl,6- fucosyltransferase activity. The term core al ,6-fucosyltransferase activity encompasses both expression of the core αl ,6-fucosyltransferase gene as well as interaction of the core αl ,6-fucosyltransferase enzyme with its substrate.
[0139] As used herein, the term Fc-mediated cellular cytotoxicity includes antibody-dependent cellular cytotoxicity and cellular cytotoxicity mediated by a soluble Fc-fusion protein containing a human Fc-region. It is an immune mechanism leading to the lysis of "antibody-targeted cells" by "human immune effector cells", wherein:
[0140] The human immune effector cells are a population of leukocytes that display Fc receptors on their surface through which they bind to the Fc-region of antibodies or of Fc-fusion proteins and perform effector functions. Such a population may include, but is not limited to, peripheral blood mononuclear cells (PBMC) and/or natural killer (NK) cells.
[0141] The antibody-targeted cells are cells bound by the antibodies or Fc-fusion proteins. The antibodies or Fc fusion-proteins bind to target cells via the protein part N-terminal to the Fc region.
[0142] As used herein, the term increased Fc-mediated cellular cytotoxicity is defined as either an increase in the number of "antibody-targeted cells" that are lysed in a given time, at a given concentration of antibody, or of Fc-fusion protein, in the medium surrounding the target cells, by the mechanism of Fc- mediated cellular cytotoxicity defined above, and/or a reduction in the concentration of antibody, or of Fc-fusion protein, in the medium surrounding the target cells, required to achieve the lysis of a given number of "antibody-targeted cells", in a given time, by the mechanism of Fc -mediated cellular cytotoxicity. The increase in Fc-mediated cellular cytotoxicity is relative to the cellular cytotoxicity mediated by the same antibody, or Fc-fusion protein, produced by the same type of host cells, using the same standard production, purification, formulation and storage methods, which are known to those skilled in the art, but that has not been produced by host cells engineered to express the glycosyltransferase GnTIII by the methods described herein.
[0143] By antibody having increased antibody dependent cellular cytotoxicity
(ADCC) is meant an antibody, as that term is defined herein, having increased ADCC as determined by any suitable method known to those of ordinary skill in the art. One accepted ADCC assay is described in the Examples set forth herein below. Another accepted in vitro ADCC assay is as follows:
1) the assay uses target cells that are known to express the target antigen recognized by the antigen-binding region of the antibody;
2) the assay uses human peripheral blood mononuclear cells (PBMCs), isolated from blood of a randomly chosen healthy donor, as effector cells;
3) the assay is carried out according to following protocol: i) the PBMCs are isolated using standard density centrifugation procedures and are suspended at 5 x 106 cells/ml in PvPMI cell culture medium; ii) the target cells are grown by standard tissue culture methods, harvested from the exponential growth phase with a viability higher than 90%, washed in RPMI cell culture medium, labeled with 100 micro-Curies Of51Cr, washed twice with cell culture medium, and resuspended in cell culture medium at a density of 105 cells/ml; iii) 100 microliters of the final target cell suspension above are transferred to each well of a 96-well microtiter plate; iv) the antibody is serially-diluted from 4000 ng/ml to 0.04 ng/ml in cell culture medium and 50 microliters of the resulting antibody solutions are added to the target cells in the 96-well microtiter plate, testing in triplicate various antibody concentrations covering the whole concentration range above; v) for the maximum release (MR) controls, 3 additional wells in the plate containing the labeled target cells, receive 50 microliters of a 2% (V /V) aqueous solution of non-ionic detergent (Nonidet, Sigma, St. Louis), instead of the antibody solution (point iv above); vi) for the spontaneous release (SR) controls, 3 additional wells in the plate containing the labeled target cells, receive 50 microliters of RPMI cell culture medium instead of the antibody solution (point iv above); vii) the 96-well microtiter plate is then centrifuged at 50 x g for 1 minute and incubated for 1 hour at 40C; viii) 50 microliters of the PBMC suspension (point i above) are added to each well to yield an effector.iarget cell ratio of 25:1 and the plates are placed in an incubator under 5% CO2 atmosphere at 370C for 4 hours; ix) the cell-free supernatant from each well is harvested and the experimentally released radioactivity (ER) is quantified using a gamma counter; x) the percentage of specific lysis is calculated for each antibody concentration according to the formula (ER-MR)/(MR-SR) x 100, where ER is the average radioactivity quantified (see point ix above) for that antibody concentration, MR is the average radioactivity quantified (see point ix above) for the MR controls (see point v above), and SR is the average radioactivity quantified (see point ix above) for the SR controls (see point vi above);
4) "increased ADCC" is defined as either an increase in the maximum percentage of specific lysis observed within the antibody concentration range tested above, and/or a reduction in the concentration of antibody required to achieve one half of the maximum percentage of specific lysis observed within the antibody concentration range tested above. The increase in ADCC is relative to the ADCC, measured with the above assay, mediated by the same antibody, produced by the same type of host cells, using the same standard production, purification, formulation and storage methods, which are known to those skilled in the art, but that has not been produced by host cells engineered to overexpress GnTIII.
Antigen Binding Molecules with Heavy Chain and/or Light Chain Amino Acid Substitutions
[0144] In one aspect, the present invention is directed to ABMs comprising modfied heavy chain and/or light chain V regions and/or C regions, and to the discovery that the ability of these ABMs to induce cell signaling activity of a target antigen and/or mediate cross-linking of target antigen can be enhanced (i.e., induced or increased) or reduced (i.e., inhibited or decreased) by such modifications. Thus, the present invention provides polypeptides, including ABMs, having modified heavy chain and/or light chain V regions and/or C regions, nucleic acid sequences (e.g. vectors) encoding such polypeptides, methods for generating polypeptides having modified heavy chain and/or light chain V regions and/or C regions, and methods for using same in the treatment of various diseases and disorders.
[0145] It is known that several mechanisms are involved in the therapeutic efficacy of antibodies, including antibody dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), and the induction of growth arrest or apoptosis and the blocking or inhibition of cell growth, cell proliferation, cell survival and/or other cellular events. For example, instances of induction of cell death and other cell signaling events by agonistic monoclonal antibodies have been reported. Cerisano et al, showed the induction of caspase- independent cell death characterized by apoptosis-like features (including phosphatidyl-serine (PS) exposure, morphological changes and/or propidium- iodide (PI) uptake), as well as homotypic aggregation of Ewing's sarcoma cells, by stimulation with agonistic antibodies against the transmembrane glycoprotein, CD99 (e.g., anti-CD99013 MAb and 0662 MAb) (Cerisano et al, Oncogene 23: 5664-5674 (2003)). Likewise, Hahn et al reported activation of MAPK signaling pathways by engagement of CD99 with anti-CD99 monoclonal antibodies (e.g., DNl 6 and YG32), which led to homotypic aggregation of cells (Hahn et al, FEBS Letters 470: 350-354 (2000)). Pettersen et al. identified a new functional domain of CD99 that could be activated by the anti-CD99 monoclonal antibody, Ad20, which activation induced apoptosis in transformed T cells (Pettersen et al, J. Immunol. 166:4931-4942 (2001)). Monoclonal antibodies against CD47 (e.g., B6H12) can also induce caspase-independent cell death, which is associated with cytoskeletal reorganization signaling pathways (Mateo et al, Blood 100:2882- 2890 (2002)). Each of the above-mentioned references is incorporated herein by reference in its entirety.
[0146] In other examples, certain antibodies against CD20 (e.g., rituximab and tositumomab) and CD52 (CAMPATH-IH) have been shown to directly induce apoptosis in tumor cells. See Ludwig et al, Oncogene 22: 9097-9106 (2003). For rituximab and several other monoclonal antibodies with little or no signaling activity (anti-CD 19, CD21, CD22 and Her2), ability to induce apoptosis or growth arrest was enhanced by chemically converting the antibodies into IgG- IgGhomodimers. Ghetie et al, Proc. Natl. Acad. ScL 94:7509-14 (1997). It was speculated that the enhancement was due to increased negative signaling and/or hypercrosslinking by the tetravalent antibody homodimers. Ghetie et al, Proc. Natl. Acad. Sci. 94:7509-14 (1997). Cross-linking and increased apoptosis have also been achieved through the use of secondary antibodies or Fc-receptor- bearing accessory cells. See Jazhirehi and Bonavida, Oncogene 24:2121-43 (2005). Each of the above-mentioned references is incorporated herein by reference in its entirety.
[0147] Without wishing to be bound by theory, the present inventors have determined that modifications to the amino acid residues in the elbow hinge region of an antigen binding molecule can affect the ability of the ABM to induce or inhibit signaling activity and/or cross-linking of target antigen. The angle of the elbow hinge region controls the orientation of the V region with respect to the C region of an immunoglobulin, and as such, facilitates the interactions of antibodies with antigen and effector proteins. See Lesk and Chothia, Nature 335: 188-90 (1988). Lesk and Chothia identified the residues that make up the molecular ball-and-socket joint of the elbow binge region in antibodies, i.e., Kabat positions 11, 110, and 112 in the VH region and positions 149 and 150 in the CHl region, and noted the high degree of conservation across antibodies of residues that make up this joint. Lesk and Chothia, Nature 335: 188-90 (1988) (herein incorporated by reference in its entirety). However, they did not make modifications to the ball-and-socket residues or the residues in their vicinity. Landolfi et al. showed that modifications to Kabat positions 10-13 in AF2, a neutralizing antibody against human IFNγ, resulted in a significant loss in neutralizing activity of the antibody, but did not affect binding of the antibody to its target antigen. Landolfi et al, J. Immunol. 166: 1748-54 (2001) (herein incorporated by reference in its entirety). However, Landolfi et al. did not show an effect on the ability of an antibody to induce cell signaling or to mediate antigen cross-linking.
[0148] With a multivalent ABM, the ability to change the orientation of the antigen binding sites allows for the adjustment of the proximity of bound antigen units when it is complexed with the multiple antigen binding sites. The proximity of the antigen units to each other facilitates greater or lesser interaction (e.g., cross-linking, dimerization, etc.) between the antigen units. For example, if the elbow angle of each VH/VL-CHl/CL pair in an ABM is oriented such that the antigen binding sites are brought into closer proximity to each other, the bound antigen units (e.g, cell surface receptor molecules) will also be brought into closer proximity to each other or brought into a conformation that is more favorable for interaction. This proximity or conformational change can mediate interactions, for example, cross4inking and oligomerization, between the bound antigens. On the other hand, orientation of the antigen binding sites so that they are farther apart or have a less favorable conformation can prevent them from interacting.
[0149] Amino acid residues at the VL-CL interface can also be modified to affect the antigen binding site orientation. For example, Kabat residues 40, 80, 83, 105, and 106 in the light chain variable region frameworks are situated at the VL/CL interface.
[0150] The activity of any cell signaling mechanisms can be affected (i.e. induced or inhibited) by the ABMs of the present invention. In one aspect of the invention, the cell signaling mechanisms involved are those initiated through cell surface receptor proteins including ion-channel linked, G-protein-linked, and enzyme-linked cell-surface receptor proteins. See generally, Chapter 15: Cell Signaling in MOLECULAR BIOLOGY OF THE CELL, Alberts et ah, eds., (3d ed. 1994) (incorporated herein by reference). Thus, for example, the cell signaling activities of the present invention include, but are not limited to, those which result in apoptosis, cell differentiation, cell growth, cell proliferation, and cell survival, as well as any of the signaling steps along the pathway. In one embodiment, the cell signaling activity occurs through an enzyme-linked receptor; in a particular embodiment, the enzyme-linked receptor is a receptor tyrosine kinase. In another embodiment, the cell signaling activity is through an ion channel-linked receptor.
[0151] The modified heavy chain or light chain V regions and/or C regions of the
ABMs of the present invention differ from the corresponding nonmodified parent polypeptide (e.g., a parent antigen binding molecule) regions by at least one amino acid substitution. The "parent," "starting," or "nonmodified" polypeptide preferably comprises at least a portion of an antibody heavy chain or light chain, and may be prepared using techniques available in the art for generating polypeptides comprising a heavy chain V region or CHl region or portion thereof and/or a light chain V or C region or portion thereof, hi specific embodiments, the parent polypeptide is an antigen binding molecule and comprises at least a portion of a VH or VL region. In certain embodiments, a modified heavy chain and/or light chain V region may be generated (e.g. according to the methods disclosed herein) and can be fused to a heterologous polypeptide of choice, such as an antibody Fc. In one embodiment of the present invention, a modified ABM or fragment thereof comprises a fusion protein, wherein a modified heavy chainV region or fragment thereof is fused to a heavy chain constant region selected from the group consisting of IgA, IgG, IgE, IgD, and IgM, or a fragment or derivative thereof. In a particular embodiment, the heavy chain constant region is IgG. hi another embodiment of the present invention, a modified ABM or fragment thereof comprises a fusion protein, wherein a modified light chain V region or fragment thereof is fused to a light chain constant region selected from the group consisting of IgA, IgG, IgE, IgD, and IgM, or a fragment or derivative thereof. In a particular embodiment, the light chain constant region is IgG. hi specific embodiments, the polypeptides of the invention comprise a whole antibody (e.g., IgG) comprising light chains and heavy chains having a modified heavy chain and/or light chain V region.
[0152] Polynucleotides encoding a polypeptide comprising a modified heavy chain V region or CHl region or light chain V region or CL region may be prepared by methods known in the art using the guidance of the present specification for particular sequences. These methods include, but are not limited to, preparation by site-directed (or oligonucleotide-mediated) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared nucleic acid encoding the polypeptide. Site-directed mutagenesis is a preferred method for preparing substitution variants. This technique is well known in the art (see e.g., Carter et a Nucleic Acids Res. 13: 4431-4443 (1985) and Kunkel et. al, Proc. Natl. Acad. ScL USA 82: 488 (1987), both of which are hereby incorporated by reference). Briefly, in carrying out site directed mutagenesis of DNA, the starting DNA is altered by first hybridizing an oligonucleotide encoding the desired mutation to a single strand of such starting DNA. After hybridization, a DNA polymerase is used to synthesize an entire second strand, using the hybridized oligonucleotide as a primer, and using the single strand of the starting DNA as a template. Thus, the oligonucleotide encoding the desired mutation is incorporated in the resulting double-stranded DNA.
[0153] PCR mutagenesis is also suitable for making amino acid sequence variants of the nonmodified starting polypeptide (see, e.g., Vallette et. al, Nuc. Acids Res. 17: 723-733 (1989),herebyincorporatedbyreference). Briefly, when small amounts of template DNA are used as starting material in a PCR, primers that differ slightly in sequence from the corresponding region in a template DNA can be used to generate relatively large quantities of a specific DNA fragment that differs from the template sequence only at the positions where the primers differ from the template.
[01541 Another method for preparing ABM variants, cassette mutagenesis, is based on the technique described by Wells et al, Gene 34: 315-323 (1985), hereby incorporated by reference. The starting material is the plasmid (or other vector) comprising the starting polypeptide DNA to be modified. The codon(s) in the starting DNA to be mutated are identified. There must be a unique restriction endonuclease site on each side of the identified mutation site(s). If no such restriction sites exist, they may be generated using the above-described oligonucleotide-mediated mutagenesis method to introduce them at appropriate locations in the starting polypeptide DNA. The plasmid DNA is cut at these sites to linearize it. A double-stranded oligonucleotide encoding the sequence of the DNA between the restriction sites but containing the desired mutation(s) is synthesized using standard procedures, wherein the two strands of the oligonucleotide are synthesized separately and then hybridized together using standard techniques. This double-stranded oligonucleotide is referred to as the cassette. This cassette is designed to have 5' and 3' ends that are compatible with the ends of the linearized plasmid, such that it can be directly ligated to the plasmid. This plasmid now contains the mutated DNA sequence.
[0155] Alternatively, or additionally, the desired amino acid sequence encoding a polypeptide variant can be determined, and a nucleic acid sequence encoding such an amino acid sequence variant can be generated synthetically.
[0156] The amino acid sequence of the parent polypeptide may be modified to generate an ABM having a modified heavy chain V region and/or modified CHl region, and/or a modified light chain V region and/or modified CL region, with altered ability to induce cell signaling activity of a target antigen when the modified ABM is complexed with (e.g., bound to) the target antigen. The cell signaling activity can be agonist activity or antagonist activity. According to one aspect of the invention, agonist activity is induced by a modified antigen binding molecule when it binds to a cell membrane-associated receptor and initiates a cell signaling pathway. In a specific embodiment, the cell signaling pathway is an apoptosis pathway. In another embodiment, the cell signaling pathway is a cell differentiation pathway. According to another aspect of the invention, antagonist activity by a modified antigen binding molecule occurs, for example, when the ABM binds to a cell membrane-associated receptor and prevents the induction of a cell signaling pathway or disrupts an ongoing signal. Antagonist activity may be achieved, for example, by blocking the binding and subsequent signal transduction of an endogenous ligand and/or by preventing the cross-linking or oligomerization of receptors or other molecules that would be necessary for induction of a cell signaling pathway. In one embodiment, the cell signaling pathway that is inhibited or disrupted is a cell growth pathway. In another embodiment, the cell signaling pathway that is inhibited or disrupted is a cell division pathway. In another embodiment the cell signaling pathway that is1 inhibited or disrupted is a cell survival pathway. Likewise, the amino acid sequence of the parent polypeptide may also be modified to generate an ABM having a modified heavy chain V region or modified C region (e.g., a modified CHl region), and/or amodified light chain V region and/or modified CL region, with altered ability to mediate cross-linking of one or more target antigens when the modified ABM is complexed with (e;g., bound to) the target antigen(s). hi one embodiment, the bound target antigens (e.g, cell surface receptor molecules) are brought into closer proximity to each other and/or a more favorable conformation for interaction than they would be by the corresponding non-modified parent ABM, thereby increasing cross-linking and oligomerization between the bound antigens. In another embodiment, the bound target antigens (e.g, cell surface receptor molecules) are kept farther apart from each other, and/or in a less favorable conformation for interaction than they would be by the corresponding non-modified parent ABM, thereby reducing or preventing cross-linking and oligomerization between the bound antigens. In a particular embodiment, the increased cross-linking or oligomerization results in increased apoptosis. hi another embodiment, the increased cross-linking or oligomerization results in increased cell differentiation. In another embodiment, the reduction in cross-linking or oligomerization results in decreased cell growth, decreased cell division, or decreased cell survival. [0158] Substantial modifications in the biological properties of the heavy chain V region or CHl region, or light chain V region or CL region, maybe accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Naturally occurring residues are divided into classes based on common side-chain properties:
(1) hydrophobic: met, ala, val, leu, ile;
(2) neutral hydrophilic: cys, ser, thr;
(3) acidic: asp, glu;
(4) basic: asn, gin, his, lys, arg;
(5) residues that influence chain orientation: gly, pro; and
(6) aromatic: trp, tyr, phe.
[0159] Non-conservative substitutions will entail exchanging a member of one of these classes for a member of another class. Conservative substitutions will entail exchanging a member of one of these classes for another member of the same class.
Exemplary Polypeptides Comprising Modified ABMs
[0160] In one aspect, the present invention is related to antigen binding molecues with amino acid modifications that alter the ability of the ABMs to induce cell signaling activity and/or to mediate cross-linking of antigens. In one embodiment, the modification to the ABM comprises at least one amino acid residue substitution in at least one framework region of the heavy chain or light chain variable region as compared to a parent molecule. In a particular embodiment, the substitution replaces an amino acid residue in heavy chain FRl . In a preferred embodiment, the modification to the ABM comprises a substitution of an amino acid residue at one or more of Kabat positions 8, 9, 10, 11, 12, or 13 in the heavy chain variable region. In another embodiment, the i modification to the ABM comprises a substitution of an amino acid residue in heavy chain FR4. In a particular embodiment, the modification to the ABM comprises a substitution of an amino acid residue at one or more of Kabat positions 110 or 112 in the heavy chain variable region. In another embodiment, the modification to the ABM comprises at least one amino acid residue substitution in the light chain at the interface between the V and C regions. In a more particular embodiment, the modification to the ABM comprises a substitution of an amino acid residue at one or more of Kabat positions 40, 80, 83, 105, or 106.
[0161] In one embodiment, an amino acid may be substituted by generating a point mutation in the parent sequence that results in the desired change in the amino acid residue(s). Alternatively, the modification to the ABM may comprise replacing an entire framework region of a parent molecule with a framework region that comprises a desired amino acid residue at a particular position. In a particular embodiment, the modification to the ABM comprises replacing the FRl of a parent molecule with the FRl encoded by a germline variable gene, sequence.
[0162] Ih another embodiment of the invention, the ABM comprises at least a
CHl region and modification of the ABM comprises at least one amino acid residue substitution as compared to a parent polypeptide. In a particular embodiment, the modification to the ABM comprises substitution of one or more of the amino acid residues at positions 148, 149 and/or 150 in the heavy chain constant region.
[0163] In another aspect, the invention is directed to modified antigen binding molecules comprising one or more truncated CDRs of a parent antigen binding molecule. Such truncated CDRs will contain, at a minimum, the specificity- determining amino acid residues for the given CDR. By "specificity-deterrnining residue" is meant those residues that are directly involved in the interaction with the antigen. In general, only about one-fifth to one-third of the residues in a given CDR participate in binding to antigen. The specificity-determining residues in a particular CDR can be identified by, for example, computation of interatomic contacts from three-dimensional modeling and determination of the sequence variability at a given residue position in accordance with the methods described in Padlan et al, FASEB J. P(7J:133-139 (1995), the contents of which are hereby incorporated by reference in their entirety.
[0164] Accordingly, the invention is also directed to an isolated polynucleotide comprising at least one complementarity determining region of a parent molecule, or a variant or truncated form thereof containing at least the specificity- determining residues for said complementarity determining region, wherein said isolated polynucleotide encodes a fusion polypeptide. Preferably, such isolated polynucleotides encode a fusion polypeptide that is a modified antigen binding molecule. Ih one embodiment, the polynucleotide comprises three complementarity determining regions of parent molecule, or variants or truncated forms thereof containing at least the specificity-determining residues for each of said three complementarity determining regions. In another embodiment, the polynucleotide encodes the entire variable region of the light or heavy chain of a chimeric (e.g., humanized) antibody. The invention is further directed to the polypeptides encoded by such polynucleotides.
[0165] In another embodiment, the invention is directed to a modified antigen binding molecule comprising at least one complementarity determining region of a parent molecule, or a variant or truncated form thereof containing at lest the specificity-determining residues for said complementarity determining region, and comprising a sequence derived from a heterologous polypeptide. In one embodiment, the modified antigen binding molecule comprises three complementarity determining regions of the parent moleclue, or variants or truncated forms thereof containing at least the specificity-determining residues for each of said three complementarity determining regions. Jn another aspect, the modified antigen binding molecule comprises the variable region of an antibody light or heavy chain. In one particularly useful embodiment, the antigen binding molecule is a chimeric, e.g., humanized, antibody. The invention is also directed to methods of making such modified antigen binding molecules, and the use of same in the treatment of disease, including cell proliferation disorders.
[0166] It is known that several mechanisms are involved in the therapeutic efficacy of antibodies, including antibody dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), and the induction of growth arrest, cell differentiation, or apoptosis.
[0167] The present invention is directed to modified ABMs that have increased ability to induce apoptosis compared to the corresponding non-modified parent ABM. For example, a parent ABM that has little or no ability to induce apoptosis may be modified according to the present invention to generate a modified ABM that does have the ability to induce apoptosis or that has an increased ability to induce apoptosis. The present invention is also directed to modified ABMs that have increased ability to induce growth arrest or cell differentiation as compared to the corresponding non-modified parent ABM. For example, a parent ABM that has little or no ability to induce growth arrest or cell differentiation may be modified according to the present invention to generate a modified ABM that does have the ability to induce growth arrest or differentiation or that has an increased ability to induce growth arrest or differentiation.
[0168] With respect to anti-CD20 antibodies in particular, for example, the majority of experimental evidence indicates that rituximab operates through conventional effector mechanisms measured by CDC and ADCC assays. Similarly, it has been shown that the resistance of different lymphoma cells to rituximab in vivo is a function of their sensitivity to CDC in vitro. In contrast, the mode of action in vivo of another anti-CD20 antibody that has been approved for therapeutic use, B 1 , requires neither complement nor natural killer (NK) cell activity. Rather, the efficacy of Bl in vivo is due to its ability to induce potent apoptosis. In general, anti~CD20 monoclonal antibodies fall into two distinct categories based on their mechanism of action in eradicating lymphoma cells. Type I anti-CD20 antibodies primarily utilize complement to kill target cells, while Type II antibodies operate by different mechanisms, primarily apoptosis. Rituximab and 1F5 are examples of Type I anti~CD20 antibodies, whereas Bl is an example of a Type II antibody. See, e.g., Cragg, M.S. and Glennie, M.J., Blood 103(7):2738-2743 (April 2004); Teeling, J.L. et al., Blood 104(6): 1793- 1800 (September 2004), the entire contents of which are hereby incorporated by reference.
[0169] U.S. Pat. Appl. Pub. No. 2005/0123546 to Umafia et al. (which is herein incorporated by reference in its entirety) discloses the first known instance in which a Type I anti-CD20 antibody was engineered to have increased effector functions such as ADCC, and to generate potent apoptosis ability, effectively changing a Type I anti-CD20 antibody into a Type II anti-CD20 antibody, m one embodiment, the present invention is directed to a modified anti-CD20 antibody comprising a substitution in a heavy chain or light chain variable region compared to a Type I parent anti-CD20 antibody, wherein the substitutions) result in increased induction of apoptosis by the modified anti-CD20 antibody. In another embodiment, the present invention is directed to engineered Type II anti-CD20 antibodies having increased ADCC as a result of engineering for increased effector function and without loss of substantial ability to induces apoptosis. In one embodiment, the Type II anti-CD20 antibodies comprise a substitution in one or more amino acids in the heavy chain or light chain variable region compared to a parent molecule. In another embodiment, the Type I and/or Type π anti-CD20 antibodies have been engineered to have an altered pattern of glycosylation in the Fc region. In a particular embodiment, the altered glycosylation of the modified ABM comprises an increased level of bisected complex residues in the Fc region. In another particular embodiment, the altered glycosylation of the modified ABM comprises a reduced level of fucose residues in the Fc region. See U.S. Pat. Appl. Pub. No.20040093621 to Shitara etal, the entire contents of which is incorporated by reference. In another embodiment, the Type I or Type II anti-CD20 antibodies have undergone polypeptide engineering as taught inU.S. Pat. No.6,737,056 to Presta or U.S. Pat. Appl. Pub. No. 2004 0185045 (Macrogenics) or U.S. Pat. Appl. Pub. No. 2004 0132101 (Xencor), the entire contents of each of which are incorporated by reference. The invention is further directed to methods of making such engineered Type I or Type II antibodies and to methods of using such antibodies in the treatment of various B cell disorders, including B cell lymphomas.
Chimeric and Humanized Modified ABMs Chimeric mouse/human antibodies have been described. See e.g,
Morrison, S. L. et al, PNAS 11:6851-6854 (November 1984); European Patent Publication No. 173494; Boulianna, G. L, at al., Nature 312:642 (December 1984); Neubeiger, M. S. et al., Nature 314:268 (March 1985); European Patent Publication No. 125023; Tan et al., J Immunol. 135:8564 (November 1985); Sun, L. K et al., Hybridoma 5(1):517 (1986); Sahagan et al., J. Immunol. 137:1066- 1074 (1986). See generally, Muron, Nature 312:597 (December 1984); Dickson, Genetic Engineering News 5(3) (March 1985); Marx, Science 229:455 (August 1985); and Morrison, Science 229:1202-1207 (September 1985). Robinson etal., in PCT Publication Number WO/88104936 describe a chimeric antibody with human constant region and murine variable region, having specificity to an epitope of CD20; the murine portion of the chimeric antibody of the Robinson references is derived from the 2H7 mouse monoclonal antibody (gamma 2b, kappa). While the reference notes that the described chimeric antibody is a "prime candidate" for the treatment of B cell disorders, this statement can be viewed as no more than a suggestion to those in the art to determine whether or not this suggestion is accurate for this particular antibody, particularly because the reference lacks any data to support an assertion of therapeutic effectiveness, and importantly, data using higher order mammals such as primates or humans.
[0171 ] Methodologies for generating chimeric antibodies are available to those in the art. For example, the light and heavy chains can be expressed separately, using, for example, immunoglobulin light chain and immunoglobulin heavy chains in separate plasmids, or on a single (e.g., polycistronic) vector. These can then be purified and assembled in vitro into complete antibodies; methodologies for accomplishing such assembly have been described. See, for example, Scharff, M., Harvey Lectures 69:125 (1974). In vitro reaction parameters for the formation of IgG antibodies from reduced isolated light and heavy chains have also been described. See, for example, Sears et al, Biochem. 16(9):2016-25 (1977).
[0172] In a particularly preferred embodiment, the chimeric ABM of the present invention is a humanized antibody. Methods for humanizing non-human antibodies are known in the art. For example, humanized ABMs of the present invention can be prepared according to the methods of U.S. Pat. No.5,225,539 to Winter, U.S. Pat. No. 6,180,370 to Queen et al, or U.S. Pat. No. 6,632,927 to Adair et al, U.S. Pat. Appl. Publ. No. 2003/0039649 to Foote; U.S. Pat. Appl. Publ. No. 2004/0044187 to Sato et al; or U.S. Pat. Appl. Publ. No., 2005/0033028 to Leung et al., the entire contents of each of which are hereby incorporated by reference. Preferably, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import" variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321 :522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al, Science, 239: 1534-1536 (1988)), by substituting hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized" antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies. The subject humanized anti- CD20 antibodies will comprise constant regions of human immunoglobulin.
[0173] The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called "best-fit" method, the sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences. The human sequence which is closest to that of the rodent is then accepted as the human framework region (FR) for the humanized antibody (Sims et al., J. Immunol, 151 :2296 (1993); Chothia et al. , J MoI. Biol, 196:901 (1987)). Another method of selecting the human framework sequence is to compare the sequence of each individual subregion of the full rodent framework (i.e., FRl , FR2, FR3, and FR4) or some combination of the individual subregions (e.g., FRl and FR2) against a library of known human variable region sequences that correspond to that framework subregion (e.g., as determined by Kabat numbering), and choose the human sequence for each subregion or combination that is the closest to that of the rodent (Leung U.S. Patent Application Publication No. 2003/0040606A1, published Feb. 27, 2003). Another method uses a particular framework region derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework may be used for several different humanized antibodies (Carter et al., Proc. Natl. Acad. ScL USA, 89:4285 (1992); Presta et al., J Immunol., 151 :2623 (1993), the entire contents of each of which are herein incorporated by reference in their entireties).
[0174] It is further important that antibodies be humanized with retention of high affinity for the antigen and other favorable biological properties. To achieve this goal, according to a preferred method, humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models can be generated using computer programs familiar to those skilled in the art (e.g. Insightπ, accelrys inc (former MSI), or at http://swissmodel.expasy.org/ described by Schwede et al., Nucleic Acids Res. 2003 (13):3381-3385). Inspection of these models permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as maintained affinity for the target antigen(s), is achieved. In general, the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
[0175] In another embodiment, the antigen binding molecules of the present invention are engineered to have enhanced binding affinity according to, for example, the methods disclosed in U.S. Pat. Appl. Pub. No. 2004/0132066 to Balint et al., the entire contents of which are hereby incorporated by reference.
[0176] In a preferred embodiment, the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide having an amino acid sequence as shown in Tables 3 and/or 5, below. The invention is further directed to an isolated nucleic acid comprising a sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a nucleotide sequence shown in Tables 2 and/or 4, below. In another embodiment, the invention is directed to an isolated nucleic acid comprising a sequence that encodes a polypeptide having an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence in Tables 3 and/or 5, below. The invention also encompasses an isolated nucleic acid comprising a sequence that encodes a polypeptide having the amino acid sequence of any of the constructs in Tables 3 and/or 5, with conservative amino acid substitutions. In certain embodiments, any of the polynucleotides or polypeptides of Tables 2- 5 maybe excluded. Therefore, for example, in certain embodiments, the modified ABM, and/or the polynucleotide encoding the modified ABM, does not comprise any or all of SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, or SEQ ID NO:38. In another example, in certain embodiments, the modified ABM of the present invention does not comprise any or all of SEQ ID NOs:55-62.
[0177] In another embodiment, the present invention is directed to an isolated polypeptide comprising an amino acid sequence as shown in Tables 3 and/or 5, below. The invention is further directed to an isolated polypeptide comprising a sequence encoded by a nucleotide sequence shown in Tables 2 and/or 4, below. In another embodiment, the invention is directed to an isolated polypeptide comprising an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to an amino acid sequence in Tables 3 and/or 5, below. The invention also encompasses an isolated polypeptide comprising an amino acid sequence of any of the constructs in Tables 3 and/or 5, with conservative amino acid substitutions, hi certain embodiments, any of the polynucleotides or polypeptides of Tables 2- 5 maybe excluded. Therefore, for example, in certain embodiments, the polypeptide does not comprise an amino acid sequence corresponding to or encoded by any or all of SEQ ID NO:3, SEQ ID NO.4, SEQ ID NO:35, SEQ ID NO.36, SEQ ID NO:37, or SEQ ID NO:38. In another example, in certain embodiments, the modified ABM of the present invention does not comprise any or all of SEQ ID NOs:55-62.
TABLE 2
Figure imgf000053_0001
Figure imgf000054_0001
Figure imgf000055_0001
Figure imgf000056_0001
Figure imgf000057_0001
TABLE 3
Figure imgf000057_0002
Figure imgf000058_0001
Figure imgf000059_0001
Figure imgf000060_0001
TABLE 4
Figure imgf000060_0002
TABLE 5
Figure imgf000061_0001
In another particular embodiment, the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide having an amino acid sequence derived from a parent sequence shown in FIG. 1 and Table 6, and comprising at least one amino acid substitution in at least one heavy chain FR region. In another embodiment, the present invention is directed to an isolated polypeptide comprising an amino acid sequence derived from a parent sequence shown in FIG. 1 and Table 6, and comprising at least one amino acid substitution in at least one heavy chain FR region.
TABLE 6
Figure imgf000061_0002
Figure imgf000062_0001
In one aspect, the modified ABMs of the present invention can comprise a substitution of an entire framework region compared to aparent ABM. Thus, for example, the present invention is further directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide having at least one heavy chain FR derived from a human germline VH sequence, hi a preferred embodiment, the human VH germline sequence in the FRl region, or in the Kabat positions 8- 13 is derived from any one of the sequences identified in Table 7, below. These sequences are available from the IMGT database (http://imgt.cines.fr:8104/textes/ IMGTrepertoire), and each sequence as identified by its accession number is expressly incorporated herein by reference in its entirety.
TABLE 7
Figure imgf000062_0002
Figure imgf000063_0001
In another embodiment, the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide comprising an amino acid sequence at Kabat positions 8 to 13 of the heavy chain variable region, or any subset thereof (e.g., positions 9 to 12, positions 10-12, etc.) according to any one of the sequences presented in Table 8 below. In another embodiment, the present invention is directed to an isolated polypeptide comprising an amino acid sequence at Kabat positions 8 to 13, or any subset thereof (e.g., positions 9 to 12, 10 to 12, etc.) according to any one of the sequences presented in Table 8 below.
TABLE 8
Figure imgf000063_0002
Figure imgf000064_0001
In another embodiment, the present invention is directed to an isolated polynucleotide comprising a sequence that encodes a polypeptide comprising an amino acid sequence at Kabat positions 108 to 113 of the heavy chain variable region, or any subset thereof (e.g., positions 110 to 112, positions 110 and 112, etc.). hi a particular embodiment, the sequence at positions 108 to 113 is as shown in Table 9 below, hi another embodiment, the present invention is directed to an isolated polypeptide comprising an amino acid sequence at Kabat positions 108 to 113, or any subset thereof (e.g., positions 110 to 112, positions 110 and. 112, etc.) according to any one of the sequences presented in Table 9 below.
TABLE 9
Figure imgf000064_0002
Figure imgf000065_0001
[0182] In another embodiment, the present invention is directed to an expression vector and/or a host cell which comprise one or more isolated polynucleotides of the present invention.
[0183] Generally, any type of cultured cell line can be used to express the ABMs of the present invention, hi a preferred embodiment, CHO cells, HEK293-EBNA cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, other mammalian cells, yeast cells, insect cells, or plant cells are used as the background cell line to generate the engineered host cells of the invention.
Modified ABMs Further Comprising Fc Regions and Fc Region Variants
[0184] In one embodiment, the ABMs of the present invention comprising one or more amino acid substitutions in the heavy chain V and/or CHl regions and/or the light chain V and/or C regions may further comprise a human Fc region. In a specific embodiment, the human constant region is IgGl , as set forth in SEQ ID NOs 80 and 81, and set forth below:
IgGl Nucleotide Sequence (SEQ ID NO:80)
ACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTC
TGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAAC
CGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACC
TTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCAGCGTGGTG
ACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAA
TCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGCAGAGCCCAAATCT
TGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGG
GGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGA
TCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAA
GACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAA
TGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTG
GTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAGGAGTA
CAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCA
TCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCC CCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGT
CAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAATGGG
CAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACG
GCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAG
CAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCTCTGCACAACCA
CTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA
IgGl Amino Acid Sequence (SEQ ID NO.81)
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA
VLQSSGLYSLSSVVTWSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHT
CPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWY
VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL
PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALH
NHYTQKSLSLSPGK
[0185] However, variants and isoforms of the human Fc region are also encompassed by the present invention. For example, variant Fc regions suitable for use in the present invention can be produced according to the methods taught in U.S. Pat. No. 6,737,056 to Presta (Fc region variants with altered effector function due to one or more amino acid modifications); or in U.S. Pat. Appl. Nos. 60/439,498; 60/456,041; 60/514,549; or WO 2004/063351 (variant Fc regions with increased binding affinity due to amino acid modification); or in U.S. Pat. Appl. No. 10/672,280 or WO 2004/099249 (Fc variants with altered binding to FcgammaR due to amino acid modification), the contents of each of which is herein incorporated by reference in its entirety.
[0186] In another aspect of the invention, the ABMs comprising one or more amino acid substitutions in the heavy chain V and/or CHl regions and/or the light chain V and/or C regions may further comprise an Fc region variant. One can engineer an Fc region to produce a variant with altered binding affinity for one or more FcRs. One may, for example, modify one or more amino acid residues of the Fc region in order to alter (e.g. increase or decrease) binding to an FcR, as described in U.S. Provisional Pat. Appl. No. 60/678,776, incorporated herein by reference in its entirety. Generally, one will make an amino acid substitution at one or more of the Fc region residues identified as affecting FcR binding in order to generate such an Fc region variant. In preferred embodiments, no more than one to about ten Fc region residues will be deleted or substituted. The Fc regions herein comprising one or more amino acid modifications (e.g. substitutions) will preferably retain at least about 80%, and preferably at least about 90%, and most preferably at least about 95%, of the parent Fc region sequence or of a native sequence human Fc region.
[0187] One may also make amino acid insertion modified Fc regions, which variants have altered effector function. For example, one may introduce at least one amino acid residue (e.g. one to two amino acid residues and generally no more than ten residues) adjacent to one or more of the Fc region positions identified herein as impacting FcR binding. By adjacent is meant within one to two amino acid residues of an Fc region residue identified herein. Such Fc region variants may display enhanced or diminished FcR binding and/or effector function. In order to generate such insertion variants, one may evaluate a co- crystal structure of a polypeptide comprising abinding region of an FcR (e.g. the extracellular domain of the FcR of interest) and the Fc region into which the amino acid residue(s) are to be inserted (see, e.g., Sondermann et al. Nature 406:267 (2000); Deisenhofer, Biochemistry 20 (9): 2361-2370 (1981); and Burmeister et al, Nature 3442: 379-383, (1994), all of which are herein incorporated by reference) in order to rationally design a modified Fc region that exhibits, e.g., improved FcR binding ability.
[0188] By introducing the appropriate amino acid sequence modifications in a parent Fc region, one can generate a variant Fc region which (a) mediates one or more effector functions in the presence of human effector cells more or less effectively and/or (b) binds an Fc γ receptor (FcγR) or Fc neonatal receptor (FcRn) with better affinity than the parent polypeptide. Such modified Fc regions will generally comprise at least one amino acid modification in the Fc region.
[0189] In preferred embodiments, the parent polypeptide Fc region is a human Fc region, e.g. a native human Fc region human IgGl (A and non-A allotypes), IgG2, IgG3, IgG4, and all allotypes known or discovered from any species. Fc region. Such regions have sequences such as those disclosed in U.S. Provisional Patent Application No. 60/678,776, which is herein incorporated by reference in its entirety.
[0190] In certain embodiments, in order to generate an ABM comprising one or more amino acid substitutions in the heavy chain V and/or CHl regions and/or the light chain V and/or C regions and further comprising a modified Fc region with improved effector function (e.g., ADCC), the parent polypeptide preferably has pre-existing ADCC activity (e.g., the parent polypeptide comprises a human IgGl or human IgG3 Fc region). In some embodiments, a modified Fc region with improved ADCC mediates ADCC substantially more effectively than an . antibody with a native sequence IgGl or IgG3 Fc region.
[0191] In particular embodiments, amino acid modification(s) are introduced into the CH2 domain of the parent Fc region.
[0192] The polypeptides of the invention having modified Fc regions may be subjected to one or more further modifications, depending on the desired or intended use of the polypeptide. Such modifications may involve, for example, further alteration of the amino acid sequence (substitution, insertion and/or deletion of amino acid residues), fusion to heterologous polyp eptide(s) and/or covalent modifications. Such further modifications may be made prior to, simultaneously with, or following, the amino acid modification(s) disclosed above which result in an alteration of Fc receptor binding and/or effector function.
[0193] Alternatively or additionally, it may be useful to combine amino acid modifications with one or more further amino acid modifications that alter CIq binding and/or complement dependent cytoxicity function of the Fc region. The starting polypeptide of particular interest in this regard herein is one that binds to CIq and displays complement dependent cytotoxicity (CDC). Amino acid substitutions described herein may serve to alter the ability of the starting polypeptide to bind to CIq and/or modify its complement dependent cytotoxicity function (e.g. to reduce and preferably abolish these effector functions). However, polypeptides comprising substitutions at one or more of the described positions with improved CIq binding and/or complement dependent cytotoxicity (CDC) function are contemplated herein. For example, the starting polypeptide may be unable to bind CIq and/or mediate CDC and may be modified according to the teachings herein such that it acquires these further effector functions. Moreover, polypeptides with pre-existing CIq binding activity, optionally further having the ability to mediate CDC may be modified such that one or both of these activities are enhanced. Amino acid modifications that alter CIq and/or modify its complement dependent cytotoxicity function are described, for example, in WO00/42072, which is hereby incorporated by reference.
[0194] As disclosed above, one can design an Fc region or portion thereof with altered effector function, e.g., by modifying CIq binding and/or FcR binding and thereby changing CDC activity and/or ADCC activity. For example, one can generate a modified Fc region with improved CIq binding and improved FcγRIII binding (e.g. having both improved ADCC activity and improved CDC activity). Alternatively, where one desires that effector function be reduced or ablated, one may engineer a modified Fc region with reduced CDC activity and/or reduced ADCC activity. In other embodiments, one may increase only one of these activities, and optionally also reduce the other activity, e.g. to generate a modified Fc region with improved ADCC activity, but reduced CDC activity and vice versa.
[0195] Another type of amino acid substitution serves to alter the glycosylation pattern of the polypeptide. This may be achieved, for example, by deleting one or more carbohydrate moieties found in the polypeptide, and/or adding one or more glycosylation sites that are not present in the polypeptide. Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The peptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these peptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
[0196] hi some embodiments, the present invention provides compositions comprising a modification of a parent polypeptide having an Fc region, wherein the modified Fc region comprises at least one surface residue amino acid modification (See e.g.,Dns&rihofer, Biochemistry, 28;20(9):2361-70, April 1981, and WO00/42072, both of which are hereby incorporated by reference). In other embodiments, the present invention provides compositions comprising a modification of a parent polypeptide having an Fc region, wherein the modified Fc region comprises at least one non-surface residue amino acid modification. Ih further embodiments, the present invention comprises a variant of a parent polypeptide having an Fc region, wherein the variant comprises at least one surface amino acid modification and at least one non-surface amino acid modification. The therapeutic efficacy of the modified ABMs of the present invention can be further enhanced by producing them in a host cell that has been glycoengineered to have altered expression of at least one glycoprotein- modifying glcyosyltransferase. In one embodiment, the glycoengineered host cell further expresses one or more of the following: a polynucleotide encoding a polypeptide having GnTHI activity, a polynucleotide encoding a polypeptide having ManII activity, or a polynucleotide encoding a polypeptide having GaIT activity. In a preferred embodiment, the host cell expresses a polynucleotide encoding a polypeptide having GnTIII activity or ManH activity. In another preferred embodiment, the host cell expresses a polynucleotide encoding a polypetide having GnTIII activity as well as a polynucleotide encoding a polypeptide having ManII activity. In yet another preferred embodiment, the polypeptide having GnTIII activity is a fusion polypeptide comprising the Golgi localization domain of a Golgi resident polypeptide. In another preferred embodiment, the expression of the modified ABMs of the present invention in a host cell that expresses a polynucleotide encoding a polypeptide having GnTIII activity results in modified ABMs with increased Fc receptor binding affinity and increased effector function. Accordingly, in one embodiment, the present invention is directed to a host cell comprising (a) an isolated nucleic acid comprising a sequence encoding a polypeptide having GnTIII activity; and (b) an isolated polynucleotide encoding an ABM of the present invention, such as a chimeric, primatized or humanized antibody that binds human CD20. In a preferred embodiment, the polypeptide having GnTHI activity is a fusion polypeptide comprising the catalytic domain of GnTIII and the Golgi localization domain is the localization domain of mannosidase II. Methods for generating such fusion polypeptides and using them to produce antibodies with increased effector functions are disclosed in U.S. Provisional Pat. Appl. No. 60/495,142 and U.S. Pat. Appl. Publ. No.2004/0241817, the entire contents of eachofwhich are expressly incorporated herein by reference. In another preferred embodiment, the chimeric ABM is a chimeric antibody or a fragment thereof, having the binding specificity of the murine B-LyI antibody. In a particularly preferred embodiment, the chimeric antibody comprises a human Fc. In another preferred embodiment, the antibody is primatized or humanized. In one embodiment, one or several polynucleotides encoding an ABM of the present invention may be expressed under the control of a constitutive promoter or, alternately, a regulated expression system. Suitable regulated expression systems include, but are not limited to, a tetracycline-regulated expression system, an ecdysone-inducible expression system, a lac-switch expression system, a glucocorticoid-inducible expression system, atemperature- inducible promoter system, and a metallothionein metal-inducible expression system. If several different nucleic acids encoding an ABM of the present invention are comprised within the host cell system, some of them may be expressed under the control of a constitutive promoter, while others are expressed under the control of a regulated promoter. The maximal expression level is considered to be the highest possible level of stable polypeptide expression that does not have a significant adverse effect on cell growth rate, and will be determined using routine experimentation. Expression levels are determined by methods generally known in the art, including Western blot analysis using an antibody specific for the ABM or an antibody specific for a peptide tag fused to the ABM; and Northern blot analysis. In a further alternative, the polynucleotide may be operatively linked to a reporter gene; the expression levels of a modified ABM having substantially the same binding specificity of a parent antibody are determined by measuring a signal correlated with the expression level of the reporter gene. The reporter gene may be transcribed together with the nucleic acid(s) encoding said fusion polypeptide as a single mRNA molecule; their respective coding sequences may be linked either by an internal ribosome entry site (IRES) or by a cap-independent translation enhancer (CITE). The reporter gene may be translated together with at least one nucleic acid encoding a modified ABM having substantially the same binding specificity of a parent antibody such that a single polypeptide chain is formed. The nucleic acids encoding the AMBs of the present invention may be operatively linked to the reporter gene under the control of a single promoter, such that the nucleic acid encoding the fusion polypeptide and the reporter gene are transcribed into an RNA molecule which is alternatively spliced into two separate messenger RNA (mRNA) molecules; one of the resulting mRNAs is translated into said reporter protein, and the other is translated into said fusion polypeptide.
Expression of Modified ABMs
[01991 Methods which are well known to those skilled in the art can be used to construct expression vectors containing the coding sequence of a modified ABM having substantially the same binding specificity of a parent antibody along with appropriate transcriptional/translational control signals. These methods include in vitro recombinant DNA techniques, synthetic techniques and in vivo recombination/genetic recombination. See, for example, the techniques described in Maniatis etal, MOLECULAR CLONING A LABORATORY MANUAL, Cold Spring Harbor Laboratory, N. Y. (1989) and Ausubel et at, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Greene Publishing Associates and Wiley Interscience, N.Y (1989).
[0200] A variety of host-expression vector systems may be utilized to express the coding sequence of the ABMs of the present invention. Preferably, mammalian cells are used as host cell systems transfected with recombinant plasmid DNA or cosmid DNA expression vectors containing the coding sequence of the protein of interest and the coding sequence of the fusion polypeptide. Most preferably, CHO cells, HEK293-EBNA cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, other mammalian cells, yeast cells, insect cells, or plant cells are used as host cell system. Some examples of expression systems and selection methods are described in the following references, and references therein: Borth et at, Biotechnol. Bioen. 71(4):266-73 (2000-2001), in Werner et al, Arzneimittelforschung/Drug Res. 48(8):870-80 (1998), in Andersen and Krummen, Curr. Op. Biotechnol. 13:117-123 (2002), in Chadd and Chamow, Curr. Op. Biotechnol. 12:188-194 (2001), and in Giddings, Curr. Op. Biotechnol. 12: 450-454 (2001). In alternate embodiments, other eukaryotichost cell systems may be contemplated, including yeast cells transformed with recombinant yeast expression vectors containing the coding sequence of an ABM of the present invention, such as the expression systems taught in U.S. Pat. Appl. No. 60/344,169 and WO 03/056914 (methods for producing human-like glycoprotein in a non-human eukaryotic host cell) (the contents of each of which are incorporated by reference in their entirety); insect cell systems infected with recombinant virus expression vectors (e.g., baculo virus) containing the coding sequence of a modified ABM having substantially the same binding specificity of a parent antibody; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing the coding sequence of the ABM of the invention, including, but not limited to, the expression systems taught in U.S. Pat. No. 6,815, 184 (methods for expression and secretion of biologically active polypeptides from genetically engineered duckweed); WO 2004/057002 (production of glycosylated proteins in bryophyte plant cells by introduction of a glycosyl transferase gene) and WO 2004/024927 (methods of generating extracellular heterologous non-plant protein in moss protoplast); and U.S. Pat. Appl. Nos. 60/365,769, 60/368,047, and WO 2003/078614 (glycoprotein processing in transgenic plants comprising a functional mammalian GnTIII enzyme) (the contents of each of which are hereby incorporated by reference in their entirety); or animal cell systems infected with recombinant virus expression vectors (e.g., adenovirus, vaccinia virus) including cell lines engineered to contain multiple copies of the DNA encoding a modified ABM having substantially the same binding specificity of a parent antibody either stably amplified (CHO/dhfr) or unstably amplified in double-minute chromosomes (e.g., murine cell lines). In one embodiment, the vector comprising the polynucleotide(s) encoding the ABM of the invention is polycistronic. Also, in one embodiment the ABM discussed above is an antibody or a fragment thereof. In a preferred embodiment, the ABM is a humanized antibody. For the methods of this invention, stable expression is generally preferred to transient expression because it typically achieves more reproducible results and also is more amenable to large-scale production. Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with the respective coding nucleic acids controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker. Following the introduction of foreign DNA, engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media. The selectable marker in the recombinant plasmid confers resistance to the selection and allows selection of cells which have stably integrated the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines.
[0202] A number of selection systems may be used, including, but not limited to, the herpes simplex virus thymidine kinase (Wigler et al, Cell 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. Sd. USA 48:2026 (1962)), and adenine phosphoribosyltransferase (Lowy et al, Cell 22:817 (1980)) genes, which can be employed in tk", hgprt" or aprf cells, respectively. Also, antimetabolite resistance can be used as the basis of selection for dhfr, which confers resistance to methotrexate (Wigler et al, Natl Acad. Sd. USA 77:3567 (1989); OΗare et al, Proc. Natl Acad. ScL USA 78: 1527 (1981)); gpt, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc. Natl Acad. ScL USA 78:2072 (1981)); neo, which confers resistance to the aminoglycoside G-418 (Colberre-Garapin et al, J. MoI Biol 150:1 (1981)); and hygro, which confers resistance to hygromycin (Santerre etal, Gene 30:147 (1984) genes. Recently, additional selectable genes have been described, namely trpB, which allows cells to utilize indole in place of tryptophan; hisD, which allows cells to utilize histinol in place of histidine (Hartman & Mulligan, Proc. Natl Acad. ScL USA S5:8047 (1988)); the glutamine synthase system; and ODC (ornithine decarboxylase) which confers resistance to the ornithine decarboxylase inhibitor, 2-(difluoromethyl)-DL-ornithine, DEMO (McConlogue, in: Current Communications in Molecular Biology, Cold Spring Harbor Laboratory ed. (1987)).
Expression of Modified ABMs comprising Fc Regions with Altered Glycosylation
[0203] In another aspect, the present invention is further directed to a method for modifying the glycosylation profile of the modified ABMs comprising at least one amino acid substitution in the V or CHl region that are produced by a host cell, comprising expressing in said host cell a nucleic acid encoding a modified ABM of the invention and a nucleic acid encoding a polypeptide with GnTIII activity, or a vector comprising such nucleic acids. Preferably, the modified polypeptide is IgG or a fragment thereof comprising the Fc region. In a particularly preferred embodiment the ABM is a humanized antibody or a fragment thereof. In another embodiment, the host cell is engineered to coexpress an ABM of the invention, GnTIII and mannosidase II (ManII).
[0204] The modified ABMs produced by the host cells of the invention exhibit increased Fc receptor binding affinity and/or increased effector function as a result of the modification. In a particularly preferred embodiment the modified ABM is a humanized antibody or a fragment thereof containing the Fc region. Preferably, the increased Fc receptor binding affinity is increased binding to a Fcγ activating receptor, such as the FcγRIIIa receptor. The increased effector function is preferably an increase in one or more of the following: increased antibody-dependent cellular cytotoxicity, increased antibody-dependent cellular phagocytosis (ADCP), increased cytokine secretion, increased immune-complex- mediated antigen uptake by antigen-presenting cells, increased Fc-mediated cellular cytotoxicity, increased binding to NK cells, increased binding to macrophages, increased binding to polymorphonuclear cells (PMNs), increased binding to monocytes, increased crosslinking of target-bound antibodies, increased direct signaling inducing apoptosis, increased dendritic cell maturation, and increased T cell priming.
[0205] Effector functions can be measured and/or determined by various assays known to those of skill in the art. Various assays for measuring effector functions, including Fc receptor binding affinity and complement dependent cytotoxicity, are described in US Application Publication No.2004/0241817Al, which is herein incorporated by reference in its entirety. Cytokine secretion can be measured, for example, using a sandwich ELISA, see, e.g., McRae et al, J. Immunol. 164: 23-28 (2000) and the cytokine sandwich ELISA protocol available at www.bdbiosciences.com/pharmingen/protocols, or by the methods described in Takahashi et al, British J. Pharmacol. 137: 315-322 (2002), each of which is herein incorporated by reference in its entirety. Dendritic cell maturation, for example, can be determined using assays as set forth by Kalergis and Ravetch, J. Exp. Med. 195: 1653-59 (2002), which is herein incorporated by reference in its entirety. Examples of phagocytosis and antigen uptake/presentation assays are provided by Gresham et al, J. Exp. Med. 191: 515-28 (2000); Krauss et al, J. Immunol 153: 1769-77 (1994); wX Rafiq et al, J. Clin. Invest. 110: 71-79 (2002), and Hamano et al, J. Immunol. 164: 6113-19 (2000), each of which is herein incorporated by reference in its entirety. Down regulation of cell-surface receptors can be measured, for example, by methods set forth by Liao et at, Blood 83: 2294-2304 (1994), which is herein incorporated by reference in its entirety. General methods, protocols and assays, can be found in CELL BIOLOGY: A LABORATORY HANDBOOK, Celis, J.E., ed., (2d ed., 1998), which is herein incorporated by reference in its entirety. It is within the skill of one in the art to adapt the above-referenced methods, protocols and assays for use with the present invention.
[0206] The present invention is also directed to a method for producing an ABM of the present invention, having modified oligosaccharides in a host cell comprising (a) culturing a host cell engineered to express at least one nucleic acid encoding a polypeptide having GnTIII activity under conditions which permit the production of an ABM according to the present invention, wherein said polypeptide having GnTIII activity is expressed in an amount sufficient to modify the oligosaccharides in the Fc region of said ABM produced by said host cell; and (b) isolating said ABM. In a preferred embodiment, the polypeptide having GnTm activity is a fusion polypeptide comprising the catalytic domain of GnTiπ. In a particularly preferred embodiment, the fusion polypeptide further comprises the Golgi localization domain of a Golgi resident polypeptide.
[0207] Preferably, the Golgi localization domain is the localization domain of mannosidase II or GnTI. Alternatively, the Golgi localization domain is selected from the group consisting of: the localization domain of mannosidase I, the localization domain of GnTII, and the localization domain of α 1-6 core fucosyltransferase. The ABMs produced by the methods of the present invention have increased Fc receptor binding affinity and/or increased effector function. Preferably, the increased effector function is one or more of the following: increased Fc-mediated cellular cytotoxicity (including increased antibody- dependent cellular cytotoxicity), increased antibody-dependent cellular phagocytosis (ADCP), increased cytokine secretion, increased immune-complex- mediated antigen uptake by antigen-presenting cells, increased binding to NK cells, increased binding to macrophages, increased binding to monocytes, increased binding to polymorphonuclear cells, increased direct signaling inducing apoptosis, increased crosslinking of target-bound antibodies, increased dendritic cell maturation, or increased T cell priming. The increased Fc receptor binding affinity is preferably increased binding to Fc activating receptors such as FcγRIIIa. In a particularly preferred embodiment the ABM is a humanized antibody or a fragment thereof.
[0208] In another embodiment, the present invention is directed to a modified
ABM having substantially the same binding specificity of a parent antibody produced by the methods of the invention which has an increased proportion of bisected oligosaccharides in the Fc region of said polypeptide. It is contemplated that such an ABM encompasses antibodies and fragments thereof comprising the Fc region. In a preferred embodiment, the ABM is a humanized antibody. In one embodiment, the percentage of bisected oligosaccharides in the Fc region of the ABM is at least 50%, more preferably, at least 60%, at least 70%, at least 80%, or at least 90%, and most preferably at least 90-95% of the total oligosaccharides, ϊn yet another embodiment, the ABM produced by the methods of the invention has an increased proportion of nonfucosylated oligosaccharides in the Fc region as a result of the modification of its oligosaccharides by the methods of the present invention. In one embodiment, the percentage of nonfucosylated oligosaccharides is at least 50%, preferably at least 60% to 70%, most preferably at least 75%. The nonfucosylated oligosaccharides may be of the hybrid or complex type. In a particularly preferred embodiment, the ABM produced by the host cells and methods of the invention has an increased proportion of bisected, nonfucosylated oligosaccharides in the Fc region. The bisected, nonfucosylated oligosaccharides may be either hybrid or complex. Specifically, the methods of the present invention may be used to produce ABMs in which at least 15%, more preferably at least 20%, more preferably at least 25%, more preferably at least 30%, more preferably at least 35% of the oligosaccharides in the Fc region of the ABM are bisected, nonfucosylated. The methods of the present invention may also be used to produce polypeptides in which at least 15%, more preferably at least 20%, more preferably at least 25%, more preferably at least 30%, more preferably at least 35% of the oligosaccharides in the Fc region of the polypeptide are bisected hybrid nonfucosylated.
[0209] hi another embodiment, the present invention is directed to a modified
ABM having substantially the same binding specificity of a parent antibody engineered to have increased effector function and/or increased Fc receptor binding affinity, produced by the methods of the invention. Preferably, the increased effector function is one or more of the following: increased Fc- mediated cellular cytotoxicity (including increased antibody-dependent cellular cytotoxicity), increased antibody-dependent cellular phagocytosis (ADCP), increased cytokine secretion, increased immune-complex-mediated antigen uptake by antigen-presenting cells, increased binding to NK cells, increased binding to macrophages, increased binding to monocytes, increased binding to polymorphonuclear cells, increased direct signaling inducing apoptosis, increased crosslinking of target-bound antibodies, increased dendritic cell maturation, or increased T cell priming. In a preferred embodiment, the increased Fc receptor binding affinity is increased binding to a Fc activating receptor, most preferably FcγRIIIa. In one embodiment, the modified ABM is an antibody, an antibody fragment containing the Fc region, or a fusion protein that includes a region equivalent to the Fc region of an immunoglobulin. In a particularly preferred embodiment, the ABM is a humanized antibody.
Pharmaceutical Compositions Comprising Modified ABMs
[0210] The present invention is further directed to pharmaceutical compositions comprising the modified ABMs of the present invention and a pharmaceutically acceptable carrier.
[0211] Any conventional carrier material can be utilized. The carrier material can be an organic or inorganic one suitable for eteral, percutaneous or parenteral administration. Suitable carriers include water, gelatin, gum arabic, lactose, starch, magnesium stearate, talc, vegetable oils, polyalkylene-glycols, petroleum jelly and the like. Furthermore, the pharmaceutical preparations may contain other pharmaceutically active agents. Additional additives such as flavoring agents, stabilizers, emulsifying agents, buffers and the like may be added in accordance with accepted practices of pharmaceutical compounding.
[0212] The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
[0213] The present invention is further directed to such pharmaceutical compositions for use in the treatment or prohpylaxis of cancer. The present invention is further directed to a method for the treatment or prophylaxis of cancer comprising administering a therapeutically effective amount of the pharmaceutical composition of the invention.
[0214] Preferably, the cancer is selected from the group consisting of breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
[0215] The present invention is further directed to such pharmaceutical compositions for use in the treatment or prophylaxis of a precancerous condition or lesion. The present invention is further directed to a method for the treatment or prophylaxis of a precancerous condition or lesion comprising administering a therapeutically effective amount of the pharmaceutical composition of the invention.
[0216] Preferably, the precancerous condition or lesion is selected from the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
[0217] The present invention further provides methods for the generation and use of host cell systems for the production of glycoforms of the modified ABMs of the present invention, having increased Fc receptor binding affinity, preferably increased binding to Fc activating receptors, and/or having increased effector functions, including antibody-dependent cellular cytotoxicity. The glycoengineering methodology that can be used with the modified ABMs of the present invention has been described in greater detail in U.S. Pat. No. 6,602,684 and Provisional U.S. Patent Application No. 60/441 ,307 and WO 2004/065540, the entire contents of each of which is incorporated herein by reference in its entirety. The modified ABMs of the present invention can alternatively be glyco engineered to have reduced fucose residues in the Fc region according to the techniques disclosed in EP 1 176 195 Al, the entire contents of which is incorporated by reference herein. Generation Of Cell Lines For The Production Of Modified ABMs With Altered Glycosylation Pattern
[0218] The present invention provides host cell expression systems for the generation of the modified ABMs of the present invention having modified glycosylation patterns. In particular, the present invention provides host cell systems for the generation of glycoforms of the modified ABMs of the present invention having an improved therapeutic value. Therefore, the invention provides host cell expression systems selected or engineered to express a polypeptide having GnTHI activity. In one embodiment, the polypeptide having GnTiπ activity is a fusion polypeptide comprising the Golgi localization domain of a heterologous Golgi resident polypeptide. Specifically, such host cell expression systems may be engineered to comprise a recombinant nucleic acid molecule encoding a polypeptide having GnTIII, operatively linked to a constitutive or regulated promoter system.
[0219] In one specific embodiment, the present invention provides ahost cell that has been engineered to express at least one nucleic acid encoding a fusion polypeptide having GnTIII activity and comprising the Golgi localization domain of a heterologous Golgi resident polypeptide. In one aspect, the host cell is engineered with a nucleic acid molecule comprising at least one gene encoding a fusion polypeptide having GnTIII activity and comprising the Golgi localization domain of a heterologous Golgi resident polypeptide.
[0220] Generally, any type of cultured cell line, including the cell lines discussed above, can be used as a background to engineer the host cell lines of the present invention, hi a preferred embodiment, CHO cells, BHK cells, NSO cells, SP2/0 cells, YO myeloma cells, P3X63 mouse myeloma cells, PER cells, PER.C6 cells or hybridoma cells, other mammalian cells, yeast cells, insect cells, or plant cells are used as the background cell line to generate the engineered host cells of the invention.
[0221] The invention is contemplated to encompass any engineered host cells expressing a polypeptide having GnTIII activity, including a fusion polypeptide that comprises the Golgi localization domain of a heterologous Golgi resident polypeptide as defined herein.
[0222] One or several nucleic acids encoding a polypeptide having GnTIII activity may be expressed under the control of a constitutive promoter or, alternately, a regulated expression system. Such systems are well known in the art, and include the systems discussed above. If several different nucleic acids encoding fusion polypeptides having GnTIII activity and comprising the Golgi localization domain of a heterologous Golgi resident polypeptide are comprised within the host cell system, some of them may be expressed under the control of a constitutive promoter, while others are expressed under the control of a regulated promoter. Expression levels of the fusion polypeptides having GnTIII activity are determined by methods generally known in the art, including Western blot analysis, Northern blot analysis, reporter gene expression analysis or measurement of GnTIII activity. Alternatively, a lectin may be employed which binds to biosynthetic products of the GnTIII, for example, E4-PHA lectin. Alternatively, a functional assay which measures the increased Fc receptor binding or increased effector function mediated by antibodies produced by the cells engineered with the nucleic acid encoding a polypeptide with GnTIII activity may be used.
Identification Of Transfectants Or Transformants That Express The Protein Having A Modified Glycosylation Pattern
[0223] The host cells which contain the coding sequence of a modified ABM of the present invention and which express the biologically active gene products may be identified by at least four general approaches; (a) DNA-DNA or DNA- PvNA hybridization; (b) the presence or absence of "marker" gene functions; (c) assessing the level of transcription as measured by the expression of the respective rnRNA transcripts in the host cell; and (d) detection of the gene product as measured by immunoassay or by its biological activity.
[0224] Ih the first approach, the presence of the coding sequence of a modified
ABM of the present invention and the coding sequence of the polypeptide having GnTIII activity can be detected by DNA-DNA or DNA-RNA hybridization using probes comprising nucleotide sequences that are homologous to the respective coding sequences, respectively, or portions or derivatives thereof.
[0225] In the second approach, the recombinant expression vector/host system can be identified and selected based upon the presence or absence of certain "marker" gene functions (e.g. , thymidine kinase activity, resistance to antibiotics, resistance to methotrexate, transformation phenotype, occlusion body formation in baculovirus, etc.). For example, if the coding sequence of the modified ABM of the invention, or a fragment thereof, and the coding sequence of the polypeptide having GnTIII activity are inserted within a marker gene sequence of the vector, recombinants containing the respective coding sequences can be identified by the absence of the marker gene function. Alternatively, a marker gene can be placed in tandem with the coding sequences under the control of the same or different promoter used to control the expression of the coding sequences. Expression of the marker in response to induction or selection indicates expression of the coding sequence of the modified ABM of the invention and the coding sequence of the polypeptide having GnTIII activity.
[0226] In the third approach, transcriptional activity for the coding region of the modified ABM of the invention, or a fragment thereof, and the coding sequence of the polypeptide having GnTIII activity can be assessed by hybridization assays. For example, RNA canbe isolated and analyzed by Northern blot using a probe homologous to the coding sequences of the modified ABM of the invention, or a fragment thereof, and the coding sequence of the polypeptide having GnTIII activity or particular portions thereof. Alternatively, total nucleic acids of the host cell may be extracted and assayed for hybridization to such probes.
[0227] In the fourth approach, the expression of the protein products can be assessed immunologically, for example by Western blots, immunoassays such as radioimmuno-precipitation, enzyme-linked immunoassays and the like. The ultimate test of the success of the expression system, however, involves the detection of the biologically active gene products.
Generation And Use Of Modified ABMs Having Increased Effector Function Including Antibody-Dependent Cellular Cytotoxicity
[0228] In preferred embodiments, the present invention provides glycoforms of chimeric modified ABMs having substantially the same binding specificity of the murine B-LyI antibody and having increased effector function including antibody-dependent cellular cytotoxicity. Glycosylation engineering of antibodies has been previously described. See, e.g., U.S. Patent No. 6,602,684, incorporated herein by reference in its entirety. [0229] Clinical trials of unconjugated monoclonal antibodies (mAbs) for the treatment of some types of cancer have recently yielded encouraging results. Dillman, Cancer Biother. & Radiopharm. 12:223-25 (1997); Deo et al, Immunology Today 18:127 (1997). A chimeric, unconjugated IgGl has been approved for low-grade or follicular B-cell non-Hodgkin's lymphoma. Dillman, Cancer Biother. & Radiopharm. 12:223-25 (1997), while another unconjugated niAb, a humanized IgGl targeting solid breast tumors, has also been showing promising results in phase III clinical trials. Deo et al, Immunology Today 18:127 (1997). The antigens of these two mAbs are highly expressed in their respective tumor cells and the antibodies mediate potent tumor destruction by effector cells in vitro and in vivo. In contrast, many other unconjugated mAbs with fine tumor specificities cannot trigger effector functions of sufficient potency to be clinically useful. Frost et al, Cancer 80:311 '-33 (1997); Surfus et al, J. Immunother. 19:184-91 (1996). For some of these weaker mAbs, adjunct cytokine therapy is currently being tested. Addition of cytokines can stimulate antibody-dependent cellular cytotoxicity (ADCC) by increasing the activity and number of circulating lymphocytes. Frost et al, Cancer 80:317-33 (1997); Surfus et al, J. Immunother. 19:184-91 (1996). ADCC, a lytic attack on antibody-targeted cells, is triggered upon binding of leukocyte receptors to the constant region (Fc) of antibodies. Deo et al, Immunology Today 18: 127 (1997).
[0230] A different, but complementary, approach to increase ADCC activity of unconjugated IgGIs is to engineer the Fc region of the antibody. Protein engineering studies have shown that FcγRs interact with the lower hinge region ofthe IgG CH2 domain. Ixmd etal., J. Immunol. 157:4963-69 (1996). However, FcγR binding also requires the presence of oligosaccharides covalently attached at the conserved Asn 297 in the CH2 region. Lund et al, J. Immunol 157:4963- 69 (1996); Wright and Morrison, Trends Biotech. 15:26-31 (1997), suggesting that either oligosaccharide and polypeptide both directly contribute to the interaction site or that the oligosaccharide is required to maintain an active CH2 polypeptide conformation. Modification of the oligosaccharide structure can therefore be explored as a means to increase the affinity ofthe interaction.
[0231] An IgG molecule carries two N-linked oligosaccharides in its Fc region, one on each heavy chain. As any glycoprotein, an antibody is produced as a population of glycoforms which share the same polypeptide backbone but have different oligosaccharides attached to the glycosylation sites. The oligosaccharides normally found in the Fc region of serum IgG are of complex bi-antennary type (Wormald et al, Biochemistry 5(5:130-38 (1997), with a low level of terminal sialic acid and bisecting N-acetylglucosamine (GIcNAc), and a variable degree of terminal galactosylation and core fucosylation. Some studies suggest that the minimal carbohydrate structure required for FcγR binding lies within the oligosaccharide core. Lund et al, J. Immunol. 757:4963-69 (1996)
[0232] The mouse- or hamster-derived cell lines used in industry and academia for production of unconjugated therapeutic mAbs normally attach the required oligosaccharide determinants to Fc sites. IgGs expressed in these cell lines lack, however, the bisecting GIcNAc found in low amounts in serum IgGs. Lifely et al, Glycobiology 375:813-22 (1995). In contrast, it was recently observed that a rat myeloma-produced, humanized IgGl (CAMPATH-IH) carried a bisecting GIcNAc in some of its glycoforms. Lifely et al., Glycobiology 375:813-22 (1995). The rat cell-derived antibody reached a similar maximal in vitro ADCC activity as CAMPATH-IH antibodies produced in standard cell lines, but at significantly lower antibody concentrations.
[0233] The CAMPATH antigen is normally present at high levels on lymphoma cells, and this chimeric niAb has high ADCC activity in the absence of a bisecting GIcNAc. Lifely et al, Glycobiology 375:813-22 (1995). In the N- linked glycosylation pathway, a bisecting GIcNAc is added by GnTIII. Schachter, Biochem. Cell Biol. 54:163-81 (1986).
[0234] Previous studies used a single antibody-producing CHO cell line, that was previously engineered to express, in an externally-regulated fashion, different levels of a cloned GnTIH gene enzyme (Umana, P., et al., Nature Biotechnol. 77:176-180 (1999)). This approach established for the first time a rigorous correlation between expression of GnTIII and the ADCC activity of the modified antibody. Thus, the invention contemplates a recombinant, chimeric antibody or a fragment thereof with the binding specificity of the murine B-LyI antibody, having altered glycosylation resulting from increased GnTIII activity. The increased GnTIII activity results in an increase in the percentage of bisected oligosaccharides, as well as a decrease in the percentage of fucose residues, in the Fc region of the modified ABM. This antibody, or fragment thereof, has increased Fc receptor binding affinity and increased effector function. In addition, the invention is directed to antibody fragment and fusion proteins comprising a region that is equivalent to the Fc region of immunoglobulins.
Therapeutic Applications of Modified ABMs According to the Methods of the Invention.
[0235] In the broadest sense, the modified ABMs of the present invention can be used to target cells in vivo or in vitro that express a target antigen, in particular, where said target antigen is expressed on the cell surface. The cells expressing a target antigen can be targeted for diagnostic or therapeutic purposes. In one aspect, the modified ABMs of the present invention can be used to alter cell signaling activity in cells expressing a target antigen. In another aspect, the modified ABMs of the present invention can be used to alter the cross-linking and/or oligomerization of one or more target antigens. Target antigens for the moified ABMs of the present invention can be cell surface receptors including, but not limited to CD20, CD21, CD22, CD19, CD47, CD99, CD2, CD45, Herl (EGFR), Her2/neu, Her3, Her4, TRAIL receptors (e.g., TRAILRl, TRAILR2), TNFR, FGF receptors (e.g., FGFRl), IGF receptors, PDGF receptors, VEGF receptors, and other cell-surface associated receptors. In a particular embodiment, the target antigen is CD20. The modified ABMs of the invention also act to arrest the cell cycle, cause apoptosis of the target cells (e.g., tumor cells), inhibit angiogenesis and/or cause differentiation of target cells.
[0236] In another aspect, the invention is directed to a method for treating a disease that is treatable by altered cell signaling activity of a target antigen and/or by altered ability to mediate cross-linking of one or more target- antigens comprising administering a therapeutically effective amount of a modified ABM of the present invention to a subject in need thereof. In a specific embodiment the modified ABM is an antibody. In a more specific embodiment, the antibody is humanized. Examples of diseases for which the modified ABMs can be administered include, but are not limited to, cell proliferation diseases or disorders, autoimmune diseases or disorders, and diseases or disorders related to bacterial or viral infection.
[0237] In one embodiment, the disease or disorder is a cell proliferation disorder.
Examples of cell proliferation disorders that can be treated by an ABM of the present invention include, but are not limited to, neoplasms, cancers, malignancies and/or tumors located in the abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal;, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous system (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic region, and urogenital system. Particular neoplasms, cancers, malignancies, and/or tumors that can be treated with the ABMs of the invention include, but are not limited to, epidermal and squamous cell carcinomas, gliomas, pancreatic cancer, ovarian cancer, prostate cancer, breast cancer, bladder cancer, head and neck cancer, renal cell carcinomas, colon cancer, colorectal cancer, lung cancer, brain tumor, malignant melanoma, leukemia, lymphomas, T cell lymphomas, multiple myeloma, gastric cancer, cervical cancer, endometrial carcinoma, esophageal cancer, liver cancer, cutaneous cancer, urinary tract carcinoma, choriocarcinoma, pharyngeal cancer, laryngeal cancer, thecomatosis, androblastoma, endometrium hyperplasy, endometriosis, embryoma, fibrosarcoma, Kaposi's sarcoma, hemangioma, cavernous hemangioma, angioblastoma, retinoblastoma, astrocytoma, neurofibroma, oligodendroglioma, medulloblastoma, ganglioneuroblastoma, glioma, rhabdomyosarcoma, hamartoblastoma, osteogenic sarcoma, leiomyosarcoma, thyroid sarcoma, Ewing's sarcoma, and Wilms tumor.
[0238] Similarly, other cell proliferation disorders can also be treated with the modified ABMs of the present invention. Examples of such cell proliferation disorders include, but are not limited to hypergammaglobulinemia, lymphoproliferative disorders, paraproteinemias, purpura, sarcoidosis, Sezary Syndrome, Waldenstron's Macroglobulinemia, Gaucher's Disease, histiocytosis, and any other cell proliferation disease, besides neoplasia, located in an organ system listed above.
[0239] Examples of autoimmune diseases or disorders include, but are not limited to, immune-mediated thrombocytopenias, such as acute idiopathic thrombocytopenic purpurea and chronic idiopathic thrombocytopenic purpurea, dermatomyositis, Sydenham's chorea, lupus nephritis, rheumatic fever, polyglandular syndromes, Henoch-Schonlein purpura, poststreptococcal nephritis, erythema nodosum, Takayasu's arteritis, Addison's disease, erythema multiforme, polyarteritis nodosa, ankylosing spondylitis, Goodpasture's syndrome, thromboangitis ubiterans, primary biliary cirrhosis, Hashimoto's thyroiditis, thyrotoxicosis, chronic active hepatitis, polymyositis/dermatomyositis, polychondritis, pamphigus vulgaris, Wegener's granulomatosis, membranous nephropathy, amyotrophic lateral sclerosis, tabes dorsalis, polymyaglia, pernicious anemia, rapidly progressive glomerulonephritis and fibrosing alveolitis, inflammatory responses such as inflammatory skin diseases including psoriasis and dermatitis (e.g. atopic dermatitis); systemic scleroderma and sclerosis; responses associated with inflammatory bowel disease (such as Crohn's disease and ulcerative colitis); respiratory distress syndrome (including adult respiratory distress syndrome; ARDS); dermatitis; meningitis; encephalitis; uveitis; colitis; glomerulonephritis; allergic conditions such as eczema and asthma and other conditions involving infiltration of T cells and chronic inflammatory responses; atherosclerosis; leukocyte adhesion deficiency; rheumatoid arthritis; systemic lupus erythematosus (SLE); diabetes mellitus {e.g. Type 1 diabetes mellitus or insulin dependent diabetes mellitus); multiple sclerosis; Reynaud's syndrome; autoimmune thyroiditis; allergic encephalomyelitis; Sjorgen's syndrome; juvenile onset diabetes; and immune responses associated with acute and delayed hypersensitivity mediated by cytokines and T-lymphocytes typically found in tuberculosis, sarcoidosis, polymyositis, granulomatosis and vasculitis; pernicious amenia (Addison's disease); diseases involving leukocyte diapedesis; central nervous system (CNS) inflammatory disorder; multiple organ injury syndrome; hemolytic anemia (including, but not limited to cryoglobinemia or Coombs positive anemia); myasthenia gravis; antigen-antibody complex mediated diseases; anti-glomerular basement membrane disease; antiphospholipid syndrome; allergic neuritis; Graves' disease; Lambert-Eaton myasthenic syndrome; pemphigoid bullous; pemphigus; autoimmune polyendocrinopathies; Reiter's disease; stiff-man syndrome; Behcet disease; giant cell arteritis; immune complex nephritis; IgA nephropathy; IgM polyneuropathies; immune thrombocytopenic purpura (ITP) or autoimmune thrombocytopenia etc. The modified ABMs of the present invention can be used alone or in combination with other treatments or therapeutic agents to treat disorders that are treatable by increasing or decreasing cell signaling activity and/or cross-linking of one or more target antigens. In one embodiment, modified ABMs of the present can be used alone to target and kill tumor cells in vivo. The modified ABMs can also be used in conjunction with an appropriate therapeutic agent to treat human carcinoma. For example, the modified ABMs can be used in combination with standard or conventional treatment methods such as chemotherapy, radiation therapy or can be conjugated or linked to a therapeutic drug, or toxin, as well as to a lymphokine or a tumor-inhibitory growth factor, for delivery of the therapeutic agent to the site of the carcinoma. In particular embodiments, the conjugates of the modified ABMs of this invention include (1) immunotoxins (conjugates of the modified ABM and a cytotoxic moiety) and (2) labeled (e.g. radiolabeled, enzyme-labeled, or fluorochrome-labeled) modified ABMs in which the label provides a means for identifying immune complexes that include the labeled ABM. The modified ABMs can also be used to induce lysis through the natural complement process, and to interact with antibody dependent cytotoxic cells normally present. The cytotoxic moiety of the immunotoxin may be a cytotoxic drug or an enzymatically active toxin of bacterial or plant origin, or an enzymatically active fragment ("A chain") of such a toxin. Enzymatically active toxins and fragments thereof used are diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, and enomycin. In another embodiment, the modified ABMs are conjugated to small molecule anticancer drugs. Conjugates of the modified ABM and such cytotoxic moieties are made using a variety of bifunctional protein coupling agents. Examples of such reagents are SPDP, IT, bifunctional derivatives of imidoesters such a dimethyl adipimidate HCl, active esters such as disuccinimidyl suberate, aldehydes such as glutaraldehyde, bis- azido compounds such as bis (p-azidobenzoyl) hexanediamine, bis-diazonium derivatives such as bis-(p-diazoniumbenzoyl)-ethylenediamine, diisocyanates such as tolylene 2,6-diisocyanate, and bis-active fluorine compounds such as 1,5- difluoro-2,4-dinitrobenzene. The lysing portion of a toxin may be joined to the Fab fragment of the modified ABMs. Additional appropriate toxins are known in the art, as evidenced in e.g., published U.S. Patent Application No. 2002/0128448, incorporated herein by reference in its entirety. [0242] In one embodiment, the antigen binding molecule of the present invention is conjugated to an additional moiety, such as a radiolabel or a toxin. Such conjugated modified ABMs can be produced by numerous methods that are well known in the art.
[0243] A variety of radionuclides are applicable to the present invention and those skilled in the art are credited with the ability to readily determine which radionuclide is most appropriate under a variety of circumstances. For example, 131iodine is a well known radionuclide used for targeted immunotherapy. However, the clinical usefulness of 131iodine can be limited by several factors including: eight-day physical half-life; dehalogenation of iodinated antibody both in the blood and at tumor sites; and emission characteristics (eg, large gamma component) which can be suboptimal for localized dose deposition in tumor. With the advent of superior chelating agents, the opportunity for attaching metal chelating groups to proteins has increased the opportunities to utilize other radionuclides such as πlindium and 90yttrium. 90Yttrium provides several benefits for utilization in radioimmunotherapeutic applications: the 64 hour half- life of 9Oyttrium is long enough to allow antibody accumulation by tumor and, unlike eg, 131iodine, 90yttrium is a pure beta emitter of high energy with no accompanying gamma irradiation in its decay, with a range in tissue of 100 to 1000 cell diameters. Furthermore, the minimal amount of penetrating radiation allows for outpatient administration of 90yttrium-labeled antibodies. Additionally, internalization of labeled antibody is not required for cell killing, and the local emission of ionizing radiation should be lethal for adjacent tumor cells lacking the target antigen.
[0244] Effective single treatment dosages (i.e., therapeutically effective amounts) of 90yttrium labeled modified ABMs of the present invention range from between about 5 and about 75 mCi, more preferably between about 10 and about 40 mCi. Effective single treatment non-marrow ablative dosages of 13 iodine labeled ABMs of the present invention range from between about 5 and about 70 mCi, more preferably between about 5 and about 40 mCi. Effective single treatment ablative dosages (i.e., may require autologous bone marrow transplantation) of 1 iodine labeled antibodies of the present invention range from between about 30 and about 600 mCi, more preferably between about 50 and less than about 500 mCi. hi conjunction with a chimeric antibody according to the present invention, owing to the longer circulating half life vis-a-vis murine antibodies, an effective single treatment non-marrow ablative dosages of 131iodine labeled chimeric antibodies range from between about 5 and about 40 mCi, more preferably less than about 30 mCi. Imaging criteria for, e.g., the mindium label, are typically less than about 5 mCi.
[0245] With respect to radiolabeled antibodies of the present invention, therapy therewith can also occur using a single therapy treatment or using multiple treatments. Because of the radionuclide component, it is preferred that prior to treatment, peripheral stem cells ("PSC") or bone marrow ("BM") be "harvested" for patients experiencing potentially fatal bone marrow toxicity resulting from radiation. BM and/or PSC are harvested using standard techniques, and then purged and frozen for possible reinfusion. Additionally, it is most preferred that prior to treatment a diagnostic dosimetry study using a diagnostic labeled antibody (e.g., using u lindium) be conducted on the patient, a purpose of which is to ensure that the therapeutically labeled antibody (eg, using 90yttrium) will not become unnecessarily "concentrated" in any normal organ or tissue.
[0246] m one embodiment, a chimeric, glycoengineered modified ABM of the present invention, is conjugated to ricin A chain. Most advantageously, the ricin A chain is deglycosylated and produced through recombinant means. An advantageous method of making the ricin immunotoxin is described in Vitetta et al., Science 238, 1098 (1987), hereby incorporated by reference.
[0247] When used to kill human cancer cells in vitro for diagnostic purposes, the conjugates will typically be added to the cell culture medium at a concentration of at least about 10 nM. The formulation and mode of administration for in vitro use are not critical. Aqueous formulations that are compatible with the culture or perfusion medium will normally be used. Cytotoxicity may be read by conventional techniques to determine the presence or degree of cancer.
[0248] As discussed above, a cytotoxic radiopharmaceutical for treating cancer may be made by conjugating a radioactive isotope (e.g., I, Y, Pr) to a chimeric, glycoengineered and/or modified ABM of the present invention. The term "cytotoxic moiety" as used herein is intended to include such isotopes.
[0249] In another embodiment, liposomes are filled with a cytotoxic drug and the liposomes are coated with the ABMs of the present invention. Because many of the target molecules for the modified ABMs of the present invention expressed on the cell surface (e.g., there are many CD20 molecules on the surface of the malignant B-cell), this method permits delivery of large amounts of drug to the correct cell type.
[0250] Techniques for conjugating such therapeutic agents to antibodies are well known {see, e.g., Arnon et al., "Monoclonal Antibodies for Immunotargeting of Drugs in Cancer Therapy", in Monoclonal Antibodies and Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. 1985); Hellstrom et at, "Antibodies For Drug Delivery", in Controlled Drug Delivery (2nd Ed.), Robinson etal. (eds.), pp.623-53 (Marcel Defcker, Inc. 1987); Thorpe, "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); and Thorpe et al., "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", Immunol. Rev., 62:119-58 (1982) (each of which is incorporated by reference herein in its entirety).
[0251] Still other therapeutic applications for the ABMs of the invention include conjugation or linkage, e.g., by recombinant DNA techniques, to an enzyme capable of converting a prodrug into a cytotoxic drug and the use of that antibody-enzyme conjugate in combination with the prodrug to convert the prodrug to a cytotoxic agent at the tumor site (see, e.g., Senter et al., "Anti-Tumor Effects of Antibody-alkaline Phosphatase", Proc. Natl. Acad. ScL USA 55:4842-46 (1988); "Enhancement ofthe in vitro and in vivo Antitumor Activites of Phosphorylated Mitocycin C and Etoposide Derivatives by Monoclonal Antibody-Alkaline Phosphatase Conjugates", Cancer Research 49:5789-5792 (1989); and Senter, "Activation of Prodrugs by Antibody-Enzyme Conjugates: A New Approach to Cancer Therapy," FASEB J. 4:188-193 (1990)).
[0252] Still another therapeutic use for the ABMs ofthe invention involves use, either unconjugated, in the presence of complement, or as part of an antibody-drug or antibody-toxin conjugate, to remove tumor cells from the bone marrow of cancer patients. According to this approach, autologous bone marrow may be purged ex vivo by treatment with the antibody and the marrow infused back into the patient (see, e.g., Ramsay et al., "Bone Marrow Purging Using Monoclonal Antibodies", J. Clin. Immunol, 8(2):81-88 (1988)).
[0253] Furthermore, it is contemplated that the invention comprises a single- chain immunotoxin comprising antigen binding domains that allow substantially the same specificity of binding as a parent antibody (e.g., polypeptides comprising the CDRs of the parent antibody) and further comprising a toxin polypeptide. The single-chain immunotoxins of the invention may be used to treat human carcinoma in vivo.
[0254] Similarly, a fusion protein comprising at least the antigen-binding region of an ABM of the invention joined to at least a functionally active portion of a second protein having anti-rumor acitivty, e.g., a lymphokine or oncostatin, can be used to treat human carcinoma in vivo.
[0255] The present invention provides a method for selectively killing tumor cells expressing cell surface receptors including, but not limited to CD20, Herl (EGFR), Her2/neu, Her3, Her4, TRAIL receptors (e.g., TRAILRl, TRAILR2), TNFR, FGF receptors (e.g., FGFRl), IGF receptors, PDGF receptors, VEGF receptors, and other cell-surface associated receptors. This method comprises reacting the modified ABM of the invention (conjugated, e.g., as an immunotoxin, or unconjugated) with said tumor cells. These tumor cells maybe from a human carcinoma.
[0256] Additionally, this invention provides a method of treating carcinomas (for example, human carcinomas) in vivo. This method comprises administering to a subject a pharmaceutically effective amount of a composition containing at least one of the modified ABMs of the invention (conjugated, e.g., as an immunotoxin, or unconjugated).
[0257] In a further aspect, the invention is directed to an improved method for treating B-cell proliferative disorders including B-cell lymphoma, as well as an autoimmune disease produced in whole or in part by pathogenic autoantibodies, based on B-cell depletion comprising administering a therapeutically effective amount of an ABM of the present invention to a human subject in need thereof. In a preferred embodiment, the ABM is a glycoengineered anti-CD20 antibody with a binding specificity substantially the same as that of the murine B-LyI antibody. In another preferred embodiment the antibody is humanized. In this aspect of the invention, the ABMs of the invention are used to deplete the blood of normal B-cells for an extended period.
[0258] In accordance with the practice of this invention, the subject may be a human, equine, porcine, bovine, murine, canine, feline, and avian subjects. Other warm blooded animals are also included in this invention. [0259] The subj ect invention further provides methods for inhibiting the growth of human tumor cells, treating a tumor in a subject, and treating a proliferative type disease in a subject. These methods comprise administering to the subject an effective amount of the composition of the invention.
[0260] In one embodiment, the invention relates to an ABM according to the present invention for use in the treatment or prophylaxis of cancer, a precancerous condition or lesion, or an autoimmune disorder. In yet another embodiment, the invention relates to an ABM according to the present invention for use as a medicament for the treatment or prophylaxis of cancer, a precancerous condition or lesion, or an autoimmune disease. The cancer may be, for example, B-cell lymphoma, lung cancer, non small cell lung (NSCL) cancer, broncbioalviolar cell lung cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, prostate cancer, cancer of the bladder, cancer of the kidney or ureter, renal cell carcinoma, carcinoma of the renal pelvis, mesothelioma, hepatocellular cancer, biliary cancer, chronic or acute leukemia, lymphocytic lymphomas, neoplasms of the central nervous system (CNS), spinal axis tumors, brain stem glioma, glioblastoma multiforme, astrocytomas, schwannomas, ependymomas, medulloblastomas, meningiomas, squamous cell carcinomas, pituitary adenomas, including refractory versions of any of the above cancers, or a combination of one or more of the above cancers. The precancerous condition or lesion includes, for example, the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions. [0261] Preferably, the cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer. Examples of autoimmune disorders are
, provided, above.
[0262] Yet another embodiment is the use of the ABM according to the present invention for the manufacture of a medicament for the treatment or prophylaxis of cancer or for the treatment or prophylaxis of a precancerous condition or lesion. Cancer and precancerous condition or lesion are defined as above.
[0263] It is apparent, therefore, that the present invention encompasses pharmaceutical compositions, combinations, uses, and methods for treating human carcinomas. For example, the invention includes pharmaceutical compositions for use in the treatment of human carcinomas comprising a pharmaceutically effective amount of an antibody of the present invention and a , pharmaceutically acceptable carrier.
[0264] The ABM compositions of the invention can be administered using conventional modes of administration including, but not limited to, intravenous, intraperitoneal, oral, intralymphatic or administration directly into the tumor. Intravenous administration is preferred.
[0265] In one aspect of the invention, therapeutic formulations containing the
ABMs of the invention are prepared for storage by mixing an antibody having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG).
[0266] Exemplary anti-CD20 ABM formulations are described in WO98/56418, expressly incorporated herein by reference. This publication describes a liquid multidose formulation comprising 40 mg/mL rituximab, 25 mM acetate, 150 mM trehalose, 0.9% benzyl alcohol, 0.02% polysorbate 20 at pH 5.0 that has a minimum shelf life of two years storage at 2-80C. Another anti-CD20 formulation of interest comprises 10 mg/mL rituximab in 9.0 mg/mL sodium chloride, 7.35 mg/mL sodium citrate dihydrate, 0.7 mg/mL polysorbate 80, and Sterile Water for Injection, pH6.5. In the present invention, rituximab will be substituted by a modified ABM of the present invention.
[0267] Lyophilized formulations adapted for subcutaneous administration are described in WO97/04801. Such lyophihized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the mammal to be treated herein.
[0268] The formulation herein'may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. For example, it may be desirable to further provide a cytotoxic agent, chemotherapeutic agent, cytokine or immunosuppressive agent (e.g. one which acts on T cells, such as cyclosporin or an antibody that binds T cells, e.g., one which binds LFA-I). The effective amount of such other agents depends on the amount of antagonist present in the formulation, the type of disease or disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as used hereinbefore or about from 1 to 99% of the heretofore employed dosages.
[0269] The active ingredients may also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly- (methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microenmlsions,nano- particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).
[0270] Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antagonist, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, ρoly(2-hydroxyethyl- methacrylate), or ρoly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and γethyl-L-glutamate, non-degradable ethylene- vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid.
[0271] The formulations to be used for in vivo administration must be sterile.
This is readily accomplished by filtration through sterile filtration membranes.
[0272] The compositions of the invention may be in a variety of dosage forms which include, but are not limited to, liquid solutions or suspension, tablets, pills, powders, suppositories, polymeric microcapsules or microvesicles, liposomes, and injectable or infusible solutions. The preferred form depends upon the mode of administration and the therapeutic application.
[0273] The compositions of the invention also preferably include conventional pharmaceutically acceptable carriers and adjuvants known in the art such as human serum albumin, ion exchangers, alumina, lecithin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, and salts or electrolytes such as protamine sulfate.
[0274] The most effective mode of administration and dosage regimen for the pharmaceutical compositions of this invention depends upon the severity and course of the disease, the patient's health and response to treatment and the judgment of the treating physician. Accordingly, the dosages of the compositions should be titrated to the individual patient. Nevertheless, an effective dose of the compositions of this invention will generally be in the range of from about 0.01 to about 2000 mg/kg. [0275] The molecules described herein may be in a variety of dosage forms which include, but are not limited to, liquid solutions or suspensions, tablets, pills, powders, suppositories, polymeric microcapsules or microvesicles, liposomes, and inj ectable or infusible solutions. The preferred form depends upon the mode of administration and the therapeutic application.
[0276] The dosages of the present invention may, in some cases, be determined by the use of predictive biomarkers. Predictive biomarkers are molecular markers that are used to determine (i.e., observe and/or quanitate) a pattern of expression and/or activation of tumor related genes or proteins, or cellular components of a tumor-related signaling pathway. Elucidating the biological effects of targeted therapies in tumor tissue and correlating these effects with clinical response helps identify the predominant growth and survival pathways operative in tumors, thereby establishing a profile of likely responders and conversely providing a rationale for designing strategies to overcoming resistance to therapy. For example, where the modified ABM is an antibody specific for EGFR, biomarkers for anti-EGFR therapy may comprise one or more molecules that are in the EGFR downstream signaling pathway leading to a cell proliferation disorder including, but not limited to, Akt, RAS, RAF, MAPK, ERKl, ERK2, PKC, STAT3, STAT5 (Mitchell, Nature Biotech. 22: 363-364 (2004); Becker, Nature Biotech 22: 15-18 (2004); Tsao and Herbst, Signal 4: 4-9 (2003)). Biomarkers for anti-EGFR therapy may also comprise growth factor receptors such as EGFR, ErbB-2 (HER2/neu), and ErbB-3 (HER3), and may be positive or negative predictors of patient response to anti-EGFR therapy. For example, the growth factor receptor ErbB-3 (HER3) was determined to be a negative predictive biomarker for the anti-EGFR antibody ABX-EGF (U.S. Pat. Appl. Pub. No. 2004/0132097 Al).
[0277] Predictive biomarkers may be measured by cellular assays that are well known in the art including, but not limited to immunohistochemistry, flow cytometry, immunofluorescence, capture^and-detection assays, and reversed phase assays, and/or assays set forth in U.S. Pat. Appl. Pub. No. 2004/0132097 Al , the entire contents of which are herein incorporated by reference . Predictive biomarkers of anti-EGFR therapy, themselves, can be identified according to the techniques set forth in U.S. Pat. Appl. Pub. No. 2003/0190689A1, the entire contents of which are hereby incorporated by reference. [0278] Thus, in one aspect, the present invention provides for a method for treating a disorder that is related to altered or dysregulated cell signaling hy a target antigen and/or altered ability to mediate cross-linking and/or oligomerization of one or more target antigens comprising predicting a response to therapy with a modified ABM in a human subject in need of treatment by assaying a sample from the human subject prior to therapy with one or aplurality of reagents that detect expression and/or activation of predictive biomarkers for disorder that is related to altered or dysregulated cell signaling by a target antigen and/or altered ability to mediate cross-linking and/or oligomerization of one or more target antigens (such as cancer); determining a pattern of expression and/or activation of one or more of the predictive biomarkers, wherein the pattern predicts the human subject's response to the modified ABM therapy; and administering to a human subject who is predicted to respond positively to modified ABM treatment a therapeutically effective amount of a composition comprising a modified ABM of the present invention. As used herein, a human subject who is predicted to respond positively to modified ABM treatment is one for whom the modified ABM will have a measurable effect on the disease or disorder that is related to altered or dysregulated cell signaling by a target antigen and/or altered ability to mediate cross-linking and/or oligomerization of one or more target antigens (e.g., tumor regression/shrinkage) and for whom the benefits of modified ABM therapy are not outweighed by adverse effects (e.g., toxicity). As used herein, a sample means any biological sample from an organism, particularly a human, comprising one or more cells, including single cells of any origin, tissue or biopsy samples which has been removed from organs such as breast, lung, gastrointestinal tract, skin, cervix, ovary, prostate, kidney, brain, head and neck, or any other other organ or tissue of the body, and other body samples including, but not limited to, smears, sputum, secretions, cerebrospinal fluid, bile, blood, lymph fluid, urine and feces.
[0279] The composition comprising a modified ABM of the present invention will be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disease or disorder being treated, the particular mammal being treated, the clinic condition of the individual patient, the cause of the disease or disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners. The therapeutically effective amount of the antagonist to be administered will be governed by such considerations.
[0280] As a general proposition, the therapeutically effective amount of the antibody administered parenterally per dose will be in the range of about 0.1 to 20 mg/kg of patient body weight per day, with the typical initial range of antagonist used being in the range of about 2 to 10 mg/kg.
[0281] Also preferably, the modified ABM is used in a therapeutically effective amount from about 1.0 mg/kg to about 15 mg/kg.
[0282] Also more preferably, the modified ABM is used in a therapeutically effective amount from about 1.5 mg/kg to about 12 mg/kg.
[0283] Also more preferably, the modified ABM is used in a therapeutically effective amount from about 1.5 mg/kg to about 4.5 mg/kg.
[0284] Also more preferably, the modified ABM is used in a therapeutically effective amount from about 4.5 mg/kg to about 12 mg/kg.
[0285] Most preferably, the modified ABM is used in a therapeutically effective amount of about 1.5 mg/kg.
[0286] Also most preferably, the modified ABM is used in a therapeutically effective amount of about 4.5 mg/kg.
[0287] Also most preferably, the modified ABM is used in a therapeutically effective amount of about 12 mg/kg.
[0288] In a preferred embodiment, the modified ABM is an antibody, preferably a humanized antibody. Suitable dosages for such an unconjugated antibody are, for example, in the range from about 20 mg/m to about 1000 mg/m . In one embodiment, the dosage of the antibody differs from that presently recommended for rituximab. For example, one may administer to the patient one or more doses of substantially less than 375 mg/m2 of the antibody, e.g., where the dose is in the range from about 20 mg/m2 to about 250 mg/m2, for example from about 50 mg/m2 to about 200 mg/m2.
[0289] Moreover, one may administer one or more initial dose(s) of the antibody followed by one or more subsequent dose(s), wherein the mg/m2 dose of the antibody in the subsequent dose(s) exceeds the mg/m2 dose of the antibody in the initial dose(s). For example, the initial dose may be in the range from about 20 mg/m2 to about 250 mg/m2 (e.g., from about 50 mg/m2 to about 200mg/m2) and the subsequent dose may be in the range from about 250 mg/m2 to about 1000 mg/m2.
[0290] As noted above, however, these suggested amounts of modified ABM are subject to a great deal of therapeutic discretion. The key factor in selecting an appropriate dose and scheduling is the result obtained, as indicated above. For example, relatively higher doses may be needed initially for the treatment of ongoing and acute diseases. To obtain the most efficacious results, depending on the disease or disorder, the antagonist is administered as close to the first sign, diagnosis, appearance, or occurrence of the disease or disorder as possible or during remissions of the disease or disorder.
[0291] The modified ABM of the present invention is administered by any suitable means, including parenteral, subcutaneous, intraperitoneal, intrapulinonary, and intranasal, and, if desired for local immunosuppressive treatment, intralesional administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. In addition, the antagonist may suitably be administered by pulse infusion, e.g., with declining doses of the antagonist. Preferably the dosing is given by injections, most preferably intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
[0292] One may administer other compounds, such as cytotoxic agents, chemotherapeutic agents, immunosuppressive agents and/or cytokines with the antagonists herein. The combined administration includes coadministration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order, wherein preferably there is a time period while both (or all) active agents simultaneously exert their biological activities.
[0293] It would be clear that the dose of the composition of the invention required to achieve cures may be further reduced with schedule optimization.
[0294] In accordance with the practice of the invention, the pharmaceutical carrier may be a lipid carrier. The lipid carrier may be a phospholipid. Further, the lipid carrier may be a fatty acid. Also, the lipid carrier may be a detergent. As used herein, a detergent is any substance that alters the surface tension of a liquid, generally lowering it.
[0295] In one example of the invention, the detergent may be a nonionic detergent. Examples of nonionic detergents include, but are not limited to, polysorbate 80 (also known as Tween 80 or (polyoxyethylenesorbitan monooleate), Brij, and Triton (for example Triton WR-1339 and Triton A-20).
[0296] Alternatively, the detergent maybe an ionic detergent. An example of an ionic detergent includes, but is not limited to, alkyltrimethylarnmonium bromide.
[0297] Additionally, in accordance with the invention, the lipid carrier may be a liposome. As used in this application, a "liposome" is any membrane bound vesicle which contains any molecules of the invention or combinations thereof.
[0298] The examples below explain the invention in more detail. The following preparations and examples are given to enable those skilled in the art to more clearly understand and to practice the present invention. The present invention, however, is not limited in scope by the exemplified embodiments, which are intended as illustrations of single aspects of the invention only, and methods which are functionally equivalent are within the scope of the invention. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying drawings. Such modifications are intended to fall within the scope of the appended claims.
EXAMPLES
[0299] Unless otherwise specified, references to the numbering of specific amino acid residue positions in the following Examples are according to the Kabat numbering system.
EXAMPLE 1
Materials and Methods
Cloning and Expression of Recombinant Antibody B-LyI
[0300] B-LyI expressing hybridoma cells (see, e.g., Poppema, S., et ah, 1987,
Proceedings of the 9t l Biotest Symposium, Institute of Education, London, (Sonneborn, H.H. and Tills, D, Eds.); Ling, N.R, et ah, 1987, In Leucocyte Typing Conference III: White cell differentiation antigens, 302-355, Oxford University Press, Oxford. (AJ. McMichael, Ed.); Knapp, W. 1990. Leukocyte Typing Conference TV Proceedings, Oxford University Press, Oxford) were grown in RPMI containing 10% FBS and 4 mM L-glutamine.6 x 106 cells with a viability > 90% were harvested and total RNA was isolated using a Qiagen RNAeasy midi kit. cDNAs encoding the variable light and heavy chains of B- LyI were amplified by RT-PCR. The RT-PCR reaction was performed using the following conditions: 30 min at 50 °C for the first strand cDNA synthesis; 15 min at 95 °C initial denaturation; 30 cycles of 1 min at 940C, 1 min at 45 0C, 1.5 min at 72 °C; and a final elongation step for 10 min at 720C. The expected size of the PCR products was confirmed by gel electrophoresis. The PCR products were cloned into suitable E. coli vectors and DNA sequencing confirmed that the variable light and heavy chain encoding genes were isolated.
[0301] For construction of chimeric B-LyI expression vectors, synthetic signal sequences and appropriate restriction sites were fused to the variable chains by additional PCR reactions. After a final confirmation of the correct DNA sequence of the variable chains, they were combined with the corresponding human IgGl constant regions. Once the genes were constructed, they were cloned under control of the MPSV promoter and upstream of a synthetic polyA site, using two separate vectors, one for each chain, resulting in the plasmids pETRl 808 (heavy chain expression vector) and pETR1813 (light chain expression vector). Each vector carried an EBV OriP sequence.
[0302] Chimeric B-LyI was produced by co-transfecting HEK293-EBNA cells with vectors pETRl 808 and pETRl 813 using a calcium phosphate-transfection approach. Exponentially growing HEK293 -EBNA cells were transfected by the calcium phosphate method. Cells were grown as adherent monolayer cultures in T flasks using DMEM culture medium supplemented with 10% FCS, and were transfected when they were between 50 and 80% confluent. For the transfection of a T75 flask, 8 million cells were seeded 24 hours before transfection in 14 ml DMEM culture medium supplemented with FCS (at 10% V/V final), 250 μg/ml neomycin, and cells were placed at 37°C in an incubator with a 5% CO2 atmosphere overnight. For each T75 flask to be transfected, a solution of DNA, CaCl2 and water was prepared by mixing 47 μg total plasmid vector DNA divided equally between the light and heavy chain expression vectors, 235 μl of a IM CaCl2 solution, and adding water to a final volume of 469 μl. To this solution, 469 μl of a 50 mM HEPES, 280 mM NaCl, 1.5 mM Na2HPO4 solution at pH 7.05 were added, mixed immediately for 10 sec and left to stand at room temperature for 20 sec. The suspension was diluted with 12 ml of DMEM supplemented with 2% FCS, and added to the T75 in place of the existing medium. The cells were incubated at 37°C, 5% CO2 for about 17 to 20 hours, then medium was replaced with 12 ml DMEM, 10% FCS. For the production of unmodified antibody "chB- Ly 1 ", the cells were transfected only with antibody expression vectors pETRl 808 and pETR1813 in a 1:1 ratio. For the production of the glycoengineered antibody "chB-Lyl-ge", the cells were co-transfected with four plasmids, two for antibody expression (pETR1808 and pETR1813), one for a fusion GnTIII polypeptide expression (ρETR1519), and one for mannosidase II expression (pCLF9) at a ratio of 4:4: 1 : 1 , respectively. At day 5 post-transfection, supernatant was harvested, centrifuged for 5 min at 1200 rpm, followed by a second centrifugation for 10 min at 4000 rpm and kept at 40C.
[0303] chB-Lyl and chB-Lyl-ge were purified from culture supernatant using three sequential chromatographic steps, Protein A chromatography, cation exchange chromatography, and a size exclusion chromatography step on a Superdex 200 column (Amersham Pharmacia) exchanging the buffer to phosphate buffer saline and collecting the monomeric antibody peak from this last step. Antibody concentration was estimated using a spectrophotometer from the absorbance at 280 nm.
Oligosaccharide Analysis
[0304] Oligosaccharides were enzymatically released from the antibodies by
PNGaseF digestion, with the antibodies being either immobilized on a PVDF membrane or in solution.
[0305] The resulting digest solution containing the released oligosaccharides was either prepared directly for MALDI7TOF-MS analysis or was further digested with EndoH glycosidase prior to sample preparation for MALDI/TOF-MS analysis.
Oligosaccharide release method for PVDF membrane-immobilized antibodies
[0306] The wells of a 96-well plate made with a PVDF (Immobilon P, Millipore,
Bedford, Massachusetts) membrane were wetted with 100 μl methanol and the liquid was drawn through the PVDF membrane using vacuum applied to the Multiscreen vacuum manifold (Millipore, Bedford, Massachusetts). The PVDF membranes were washed three times with 300 μl of water. The wells were then washed with 50 μl RCM buffer (8M Urea, 360 mM Tris, 3.2 mM EDTA, pH 8.6). Between 30-40 μg antibody was loaded in a well containing 10 μl RCM buffer. The liquid in the well was drawn through the membrane by applying vacuum, and the membrane was subsequently washed twice with 50 μl RCM buffer. The reduction of disulfide bridges was performed by addition of 50 μl of 0.1 M dithiothreitol in RCM and incubation at 370C for 1 h.
[0307] Following reduction, a vacuum was applied to remove the dithiothreitol solution from the well. The wells were washed three times with 300 μl water before performing the carboxymethylation of the cysteine residues by addition of 50 μl 0.1 M iodo acetic acid in RCM buffer and incubation at room temperature in the dark for 30 min.
[0308] After carboxymethylation, the wells were drawn with vacuum and subsequently washed three times with 300 μl water. The PVDF membrane was then blocked, to prevent adsorption of the endoglycosidase, by incubating 100 μl of a 1% aqueous solution of polyvinylpyrrolidone 360 at room temperature for 1 hour. The blocking reagent was then removed by gentle vacuum followed by three washes with 300 μl water.
[0309] N-linked oligosaccharides were released by addition of 2.5 mU peptide-
N-glycosydase F ( recombinat N-Glycanase, GLYKO, Novato, CA) and 0.1 mU Sialidase (GLYKO5 Novato, CA), to remove any potential charged monosaccharide residues, in a final volume of 25 μl in 2OmM NaHCO3, pH7.0). Digestion was performed for 3 hours at 37°C.
Oligosaccharide release method for antibodies in solution
[0310] Between 40 and 50 μg of antibody were mixed with 2.5 mU of PNGaseF
(Glyko, U.S.A.) in 2 mM Tris, pH 7.0 in a final volume of 25 μl, and the mix was incubated for 3 hours at 370C. Use of Endoglycosidase H digestion of PNGaseF-released oligosaccharides for the assignment of hybrid bisected oligosaccharide structures to M ALDI/TOF-MS neutral oligosaccharide peaks
[0311] The PNGaseF released oligosaccharides were subsequently digested with
Endoglycosidase H (EC 3.2.1.96). For the EndoH digestion, 15 mU of EndoH (Roche, Switzerland) were added to the PNGaseF digest (antibody in solution method above) to give a final volume of 30 μl, and the mix was incubated for 3 hours at 37°C. EndoH cleaves between the N-acetylglucosamine residues of the 1 chitobiose core of N-linked oligosaccharides. The enzyme can only digest oligomannose and most hybrid type glycans, whereas complex type oligosaccharides are not hydrolyzed.
Sample preparation for MALDI/TOF-MS
[0312] The enzymatic digests containing the released oligosaccharides were incubated for a further 3 h at room after the addition of acetic acid to a final concentration of 150 mM, and were subsequently passed through 0.6 ml of cation exchange resin (AG50W-X8 resin, hydrogen form, 100-200 mesh, BioRad, Switzerland) packed into a micro-bio-spin chromatography column (BioRad, Switzerland) to remove cations and proteins. One microliter of the resulting sample was applied to a stainless steel target plate, and mixed on the plate with 1 μl of sDHB matrix. sDHB matrix was prepared by dissolving 2 mg of 2,5- dihydroxybenzoic acid plus 0.1 mg of 5-methoxysalicylic acid in 1 ml of ethanol/10 mM aqueous sodium chloride 1:1 (v/v). The samples were air dried, 0.2 μl ethanol was applied, and the samples were finally allowed to re-crystallize under air.
MALDI/TOF-MS
[0313] The MALDI-TOF mass spectrometer used to acquire the mass spectra was a Voyager Elite (Perspective Biosystems). The instrument was operated in the linear configuration, with an acceleration of 20 kV and 80 ns delay. External calibration using oligosaccharide standards was used for mass assignment of the ions. The spectra from 200 laser shots were summed to obtain the final spectrum. Whole blood B Cell Depletion
[0314] 495 μl heparinized blood from a healthy donor was aliquoted into 5 ml polystyrene tubes, 5 μl 100-fold concentrated antibody samples (1-1000 ng/ml final concentration) or PBS only were added and the tubes were incubated at 37°. After 24h 50 μl blood was transferred to a fresh tube and stained with anti-CD3- FITC, anti-CD19-PE and anti-CD45-CyChrome (Becton-Dickinson) for 15 min at room temperature in the dark. Before analysis, 500 μl FACS buffer (PBS containing 2% FCS and 5mM EDTA) was added to the tubes. The CD3-FITC and CD 19-PE fluorescence of the blood samples were flowcytometrically analyzed by setting a threshold on CD45-CyChrome. B cell-depletion was determined by plotting the ratio of CD19+ B cells to CD3+ T cells.
Binding of anti-CD20 Antibodies to Raji Cells
[0315] 200,000 cells in 180 μl FACS buffer (PBS containing 2% FCS and 5mM
EDTA) were transferred to 5 ml polystyrene tubes. Next, 20 μl of 10-fold concentrated anti-CD20 antibody samples (1-5000 ng/ml final concentration) or PBS only were added, and the tubes were incubated at 4°C for 30min. Subsequently, samples were washed twice with FACS buffer and pelleted at 300 x g for 3min. Supernatant was aspirated off and cells were taken up in 100 μl FACS buffer. Next, 1 μl anti-Fc-specific F(ab')2-FITC fragments (Jackson Immuno Research Laboratories, USA) was added and the tubes were incubated at 4°C for 30min. Samples were washed twice with FACS buffer and taken up in 500 μl of FACS buffer containing 0.5 μg/ml PI for analysis by Flow Cytometry. Binding was determined by plotting the geometric mean fluorescence against the antibody concentrations.
EXAMPLE 2
High Homology Acceptor Approach
[0316] The high homology antibody acceptor framework search was performed by aligning the mouse B-IyI protein sequence to a collection of human germ-line sequences and picking that human sequence that showed the highest sequence identity. Here, the sequence VH1_1O (locus 1-e, Ace. No. DP-88) from the VBase database was chosen as the heavy chain framework acceptor sequence, and the IGKV2-40 (Ace. No X59314) sequence from the MGT database was chosen to be the framework acceptor for the light chain. Onto these two acceptor frameworks, the three complementary deteπnining regions (CDRs) of the mouse heavy and light variable domains were grafted. Since the framework 4 region is not part of the variable region of the germ line V gene, the alignment for that position was done individually. The JH4 region was chosen for the heavy chain, and the JK4 region was chosen for the light chain. Molecular modelling of the designed immunoglobulin domain revealed one spot potentially requiring the murine amino acid residues instead of the human ones outside of the CDR. Reintroducing murine amino acid residues into the human framework would generate the so-called back mutations. For example, the human acceptor amino acid residue at Kabat position 27 was back mutated to a tyrosine residue. Humanized antibody variants were designed that either included or omitted the back mutations. The humanized antibody light chain did not require any back mutations. After designing the protein sequences, DNA sequences encoding these proteins were synthesized as detailed below.
Mixed Framework Approach In order to avoid introducing back mutations at critical amino acid residue positions (critical to retain good antigen binding affinity or antibody functions) of the human acceptor framework, it was investigated whether either the whole framework region 1 (FRl), or framework regions 1 (FRl) and 2 (FRZ) together, could be replaced by human antibody sequences already having donor residues, or functionally equivalent ones, at those important positions in the natural human germline sequence. For this purpose, the VH frameworks 1 and 2 of the mouse B- IyI sequence were aligned individually to human germ-line sequences. Here, highest sequence identity was not important, and was not used, for choosing acceptor frameworks, but instead matching of several critical residues was assumed to be more important. Those critical residues comprise residues 24, 71, and 94 (Kabat numbering), and also those residues at position 27, 28, and 30 (Kabat numbering), which lie outside of the CDRl definition by Kabat, but often are involved in antigen binding. The IMGT sequence IGHV3-15 (Ace No X92216) was chosen as a suitable one. After having designed the protein sequences, DNA sequences encoding these proteins were synthesized as detailed below. Using this approach no back mutations were required either for the light or heavy chain, in order to retain good levels of antigen binding.
Synthesis of the antibody genes
[0318] After having designed the amino acid sequence of the humanized antibody V region, the DNA sequence had to be generated. The DNA sequence data of the individual framework regions was found in the databases for human germ line sequences. The DNA sequence of the CDR regions was taken from the corresponding murine cDNA data. With these sequences, the whole DNA sequence was virtually assembled. Having this DNA sequence data, diagnostic restriction sites were introduced in the virtual sequence, by introducing silent mutations, creating recognition sites for restriction endonucleases. To obtain the physical DNA chain, gene synthesis was performed (e.g., Wheeler et al. 1995). In this method, oligonucleotides are designed from the genes of interest, such, that a series of oligonucleotides is derived from the coding strand, and one other series is from the non-coding strand. The 3' and 5' ends of each oligonucleotide (except the very first and last in the row) always show complementary sequences to two primers derived from the opposite strand. When putting these oligonucleotides into a reaction buffer suitable for any heat stable polymerase, and adding Mg2+, dNTPs and a DNA polymerase, each oligonucleotide is extended from its 3 ' end. The newly formed 3 ' end of one primer then anneals with the next primer of the opposite strand, and extending its sequence further under conditions suitable for template dependant DNA chain elongation. The final product was cloned into a conventional vector for propagation in E. coli.
Antibody production
[0319] Human heavy and light chain leader sequences (for secretion) were added upstream of the above variable region sequences and these were then joined upstream of human IgGl kappa constant heavy and light chain sequences, respectively, using standard molecular biology techniques. The resulting full antibody heavy and light chain DNA sequences were subcloned into mammalian expression vectors (one for the light chain and one for the heavy chain) under the control of the MPSV promoter and upstream of a synthetic polyA site, each vector carrying an EBV OriP sequence, as described in Example 1 above. Antibodies were produced as described in Example 1 above, namely by co- transfecting HEK293-EBNA with the mammalian antibody heavy and light chain expression vectors, harvesting the conditioned culture medium 5 to 7 days post- transfection, and purifying the secreted antibodies by Protein A affinity chromatography, followed by cation exchange chromatography and a final size exclusion chromatographic step to isolate pure monomeric IgGl antibodies. The antibodies were formulated in a 25 mM potassium phosphate, 125 mM sodium chloride, 100 mM glycine solution of pH 6.7. Glycoengineered variants of the humanized antibody variants were produced by co-transfection of the antibody expression vectors together with a GnT-III glycosyltransferase expression vectors, or together with a GnT-III expression vector plus a Golgi mannosidase II expression vector, as described for the chimeric antibody in Example 1 above. Glycoengineered antibodies were purified and formulated as described above for the non-glycoengineered antibodies. The oligosaccharides attached to the Fc region of the antibodies was analysed by MALDI/TOF-MS as described below.
Oligossacharide analysis
[0320] Oligosaccharide release method for antibodies in solution Between 40 and
50 μg of antibody were mixed with 2.5 mU of PNGaseF (Glyko, U.S.A.) in 2 mM Tris, pH7.0 in a final volume of 25 microliters, and the mix was incubated for 3 hours at 37°C.
Sample preparation for MALDI/TOF-MS
[0321] The enzymatic digests containing the released oligosaccharides were incubated for a further 3 h at room temperature after the addition of acetic acid to a final concentration of 150 mM, and were subsequently passed through 0.6 ml of • cation exchange resin (AG50W-X8 resin, hydrogen form, 100-200 mesh, BioRad, Switzerland) packed into a micro-bio-spin chromatography column (BioRad, Switzerland) to remove cations and proteins. One microliter of the resulting sample was applied to a stainless steel target plate, and mixed on the plate with 1 μl of sDHB matrix. sDHB matrix was prepared by dissolving 2 mg of 2,5-dihydroxybenzoic acid plus 0.1 mg of 5-methoxysalicylic acid in 1 ml of ethanol/10 mM aqueous sodium chloride 1:1 (v/v). The samples were air dried, 0.2 μl ethanol was applied, and the samples were finally allowed to re-crystallize under air.
MALDI/TOF-MS
[0322] The MALDI-TOF mass spectrometer used to acquire the mass spectra was a Voyager Elite (Perspective Biosystems). The instrument was operated in the linear configuration, with an acceleration of 2OkV and 80 ns delay. External calibration using oligosaccharide standards was used for mass assignment of the ions. The spectra from 200 laser shots were summed to obtain the final spectrum.
Antigen binding assay
[0323] The purified, monomelic humanized antibody variants were tested for binding to human CD20 on Raji B-cell lymphoma target cells using a flow cytometry-based assay, as described for the chimeric B-IyI antibody in Example , 1 above.
Binding of monomelic IgGl glycovariants to NK cells and FcγRIIIA-expressing CHO cell line
[0324] Human NK cells were isolated from freshly isolated peripheral blood mononuclear cells (PBMC) applying a negative selection enriching for CDl 6- and CD56-positive cells (MACS system, Miltenyi Biotec GmbH, Bergisch Gladbach/Germany). The purity determined by CD56 expression was between 88-95 %. Freshly isolated NK cells were incubated in PBS without calcium and magnesium ions (3 x 105 cells/ml) for 20 minutes at 37°C to remove NK cell- associated IgG. Cells were incubated at 106 cells/ml at different concentrations of anti-CD20 antibody (0, 0.1, 0.3, 1, 3, 10 μg/ml) inPBS, 0.1% BSA. After several washes antibody binding was detected by incubating with 1 :200 FITC-conjugated F(ab')2 goat anti-human, F(ab')2 specific IgG (Jackson mimunoReasearch, West Grove, PA/USA) and anti-human CD56-PE (BD Biosciences, Allschwil/Switzerland). The anti-FcgammaRIIIA 3G8 F(ab')2 fragments (Ancell, Bayport, MN/USA) were added at a concentration of 10 μg/ml to compete binding of antibody glycovariants (3 μg/ml). The fluorescence intensity referring to the bound antibody variants was determined for CD56-positive cells on a FACSCalibur (BD Biosciences, Allschwil /Switzerland). CHO cells were transfected by electroporation (280 V, 950 μF, 0.4 cm) with an expression vector coding for the FcgammaRIIIA-Vall58 α-chain and the γ-chain. Transfectants were selected by addition of 6 μg/ml puromycin and stable clones were analyzed by FACS using 10 μl FITC-conjugated-anti-FcgammaRIII 3G8 monoclonal antibody (BD Biosciences, Allschwil/Switzerland) for 106 cells. Binding of IgGl to FcgammaRIIlA-Vall58-expressing CHO cells was performed analogously to the NK cell binding described above.
ADCC assay
[0325] Human peripheral blood mononuclear cells (PBMC) were used as effector cells and were prepared using Histopaque-1077 (Sigma Diagnostics Inc., St. Louis, MO63178 USA) and following essentially the manufacturer' s instructions. In brief, venous blood was taken with heparinized syringes from volunteers. The blood was diluted 1:0.75-1.3 with PBS (not containing Ca++ or Mg++) and layered on Histopaque-1077. The gradient was centrifuged at 400 x g for 30 min at room temperature (RT) without breaks. The interphase containing the PBMC was collected and washed with PBS (50 ml per cells from two gradients) and harvested by centrifugation at 300 x g for 10 minutes at RT. After resuspension of the pellet with PBS, the PBMC were counted and washed a second time by centrifugation at 200 x g for 10 minutes at RT. The cells were then resuspended in the appropriate medium for the subsequent procedures.
[0326] The effector to target ratio used for the ADCC assays was 25:1 and 10:1 for PBMC and NK cells, respectively. The effector cells were prepared in ADVI-V medium at the appropriate concentration in order to add 50 μl per well of round bottom 96 well plates. Target cells were human B lymphoma cells (e.g., Raji cells) grown in DMEM containing 10% FCS. Target cells were washed in PBS, counted and resuspended in AIM-V at 0.3 million per ml in order to add 30,000 cells in 100 μl per micro well. Antibodies were diluted in AIM-V, added in 50 μl to the pre-plated target cells and allowed to bind to the targets for 10 minutes at RT. Then the effector cells were added and the plate was incubated for 4 hours at 37°C in a humidified atmosphere containing 5% CO2. Killing of target cells was assessed by measurement of lactate dehydrogenase (LDH) release from damaged cells using the Cytotoxicity Detection kit (Roche Diagnostics, Rotkreuz, Switzerland). After the 4-hour incubation the plates were centrifuged at 800 x g. 100 μl supernatant from each well was transferred to a new transparent flat bottom 96 well plate. 100 μl color substrate buffer from the kit were added per well. The Vmax values of the color reaction were determined in an ELISA reader at 490 nm for at least 10 min using SOFTmax PRO software (Molecular Devices, Sunnyvale, CA94089, USA). Spontaneous LDH release was measured from wells containing only target and effector cells but no antibodies. Maximal release was determined from wells containing only target cells and 1% Triton X-100. Percentage of specific antibody-mediated killing was calculated as follows: ((x- SR)/(MR - SR)* 100, where x is the mean of Vmax 'at a specific antibody concentration, SR is the mean of Vmax of the spontaneous release and MR is the mean of Vmax of the maximal release. >
Complement dependent cytotoxicity assay Target cells were counted, washed with PBS, resuspended in AIM-V
(Invitrogen) at 1 million cells per ml. 50 μl cells were plated per well in a flat bottom 96 well plate. Antibody dilutions were prepared in AlM-V and added in 50 μl to the cells. Antibodies were allowed to bind to the cells for 10 minutes at room temperature. Human serum complement (Quidel) was freshly thawed, diluted 3-fold with AIM-V and added in 50 μl to the wells. Rabbit complement (Cedarlane Laboratories) was prepared as described by the manufacturer, diluted 3 -fold with AIM-V and added in 50 μl to the wells. As a control, complement sources were heated for 30 min at 56°C before addition to the assay. The assay plates were incubated for 2h at 37°C. Killing of cells was determined by measuring LDH release. Briefly, the plates were centrifuged at 300 x g for 3 min. 50 μl supernatant per well were transferred to anew 96 well plate and 50 μl of the assay reagent from the Cytotoxicity Kit (Roche) were added. A kinetic measurement with the ELISA reader determined the Vmax corresponding with LDH concentration in the supernatant. Maximal release was determined by incubating the cells in presence of 1% Trition X-100. Whole blood B-cell depletion assay
[0328] Normal B-cell depletion in whole blood by the anti-CD20 antibodies was carried out as described in Example 1 above.
Apoptosis Assay
[0329] The apoptotic potency of the antibodies was assayed by incubating the antibody at 10 μg/rαl (saturating conditions in respect to antigen binding) with the target cells (at a target cell concentration of 5 x 105 cells/ml) overnight (16-24 h). Samples were stained with AnnV-FITC and analyzed by FACS. Assay was done in triplicates.
[0330] Detection is performed by flow cytometry by following the appearance of apoptotic markers like annexin V and phosphatidy serine. Negative control (no apoptosis induced) does not contain any antibody, but only phosphate buffered saline. Positive control (maximal apoptosis) contains 5 micromolar of the strong apoptosis inducer Camptothecin (CPT).
Results and Discussion
[0331] Comparison of the binding to human CD20 antigen of antibody variants
B-HHl, B-HH2, B-HH3, complexed with the humanized B-IyI light chain (BKVl), and the parental, chimeric antibody chB-lyl (described in Example 1 above) shows that all antibodies have a similar EC50 value, but the B-HHl construct binds with a lower intensity/stoichiometry than the variants B-HH2 and B-HH3 (Figure 11). B-HHl can be distinguished from B-HH2 and B-HH3 by its partially human CDRl and CDR2 regions (Kabat definition), as well as the Ala/Thr polymorphism at position 28 (Kabat numbering). This indicates that either position 28, the complete CDRl , and/or the complete CDR2 are important for antibody/antigen interaction.
[0332] The comparison of the B-HLl, B-HHl, and the chimeric chB-lyl parental antibody showed absence of any binding activity in the B-HLl construct, and about half of the binding intensity /stoichiometry of the B-HHl compared to B- IyI (Figure 12). Both the B-HLl as well as the B-HHl are designed based on acceptor frameworks derived from the human VHl class. Among other differences, position 71 (Kabat numbering) of the B-HLl construct is a striking difference, indicating its putative importance for antigen binding. The amino acid at position 71 is one of the residues that determine the canonical loop structure of CDR2 of the heavy chain. Here, alanine or a functional equivalent thereof (e.g., leucine, valine, or threonine {see, e.g., Morea et ah, Methods 20: 267-279 (2000)) seems to be important for antigen binding, whereas arginine seems to be detrimental to antigen binding. When comparing the antigen binding data of Figures 2, and 9 to 13, the
BHH2-BKV1, BHL8-BKV1, and BHLIl-BKVl variants show good binding affinity, among the different humanized antibody variants tested, to human CD20 on the surface of human cells. Despite similar EC50 values for antigen binding, these variants differ strongly in their behavior to induce apoptosis in CD20 positive target cells (see Figures 4- 6, 14, 15). Since the original B-IyI antibody showed low induction of apoptosis, the present inventors determined the differences between the parental B-IyI antibody contstruct and the B-HL8 and B- HH2 constructs. Seven residues were identified in the B-HH2 heavy chain that were not present in the B-HL8 or parental B-IyI heavy chains: GmI, Ala9, VaIl 1, Lysl2, Serl6, Val20, and Met48. All seven of these residues are located in the framework regions of the VH domain. The likelihood of direct antigen contact was improbable, except for Glnl. To determine if a single one of these residues alone was responsible for the newly generated apoptosis-inducing property, seven variants of the B-HL8 heavy chain were generated, that potentially could restore the apoptotic behavior of the B-HH2 construct: B- HLl l(having the mutationEl Q), B-HL12(G9A, V48M), B-HL13(L1 IV, V48M), B-HL14(V12K, V48M), B-HL15(G16S, V48M), B-HL16(L20V, V48M), andB- HL17(V48M). See SEQ ID NOs: 32, 34, 36, 38, 40, 42, and 44 (which, as presented in the Sequence Listing are not numbered according to Kabat, but whose Kabat numbering can be readily determined by one of ordinary skill). The antigen binding properties of these variants do not differ drastically with respect to EC50 values and stoichiometry (see Figure 2). However, a pronounced difference can be found in their ability to induce apotosis (Figures 4 - 6, 14, 15, and 24). The construct with the LIlV, V48M modifications, B-HL13, significantly increased the ability to induce apoptosis (see Figure 24). The V48M modification, alone, however, did not have a visible effect (see Figure 5). Hence, the residues at Kabat positions 11 and 12 influenced the apoptotic behavior to the largest extent. These residues do not affect the antigen binding directly, but rather influence the interface between the VH and CHl domains and thus act via a modification of the elbow angle.
[0334] The B-HL4 construct is derived from the B-HH2 antibody by replacing the FRl of the B-HH2 with that of the human germ line sequence IGHV1-45 (Ace No X92209). This construct shows greatly diminished antigen binding capacity, despite having different amino acids at only four positions within FRl . These residues are located at positions 2, 14, 28 and 30 (Kabat numbering). Of these, position 28 and 30 could be an influential position, since it is part of the Chothia definition of CDRl . In variants B-HH8 and 9 (both with the BKVl light chain), positions 28 and 30 are modified compared to the parental B-IyI sequence. As seen in Figure 22 the binding property does not suffer significantly if threonine 28 or threonine 30 are present (Figure 22). No back mutations were introduced in the humanized light chain, which had the full Kabat CDRl , CDR2 and CDR3 grafted. In induction of apoptosis (see Figures 14, 15 and 21), the most potent variant was humanized B-IyI variant BHH2-BKV1 (even more potent than the original chB-lyl and much more potent than an antibody with a sequence identical to rituximab, C2B8). Other humanized variants that can recover the increased apoptosis are: B-HLl 3 and B-HL14 (derivatives of BHL8), BHH8 ("mixed framework"), BHH9 ("mixed framework" with one back mutation to examine the effect of S30T), and B-HH6 (M34I derivative of B- HH2). Variant BHH4 is another humanized B-IyI variant that does not introduce additional non-human sequences. Variants B-HH5, B-HH6 and B-HH7 are derivatives of the B-HH2 construct with a partially humanized Kabat CDRl region.
[0335] Important properties of the humanized B-IyI antibody are that it is a type
II anti-CD20 antibody as defined in Cragg, M.S. and Glennie, MJ., Blood 103(7):2738-2743 (April 2004). It therefore did not induce, upon binding to CD20, any significant resistance to non-ionic detergent extraction of CD20 from the surface of CD20+ human cells, using the assay described for this purpose in Polyak, MJ. and Deans, J.P., Blood 99(9):3256-3262 (2002). It induced significantly less resistance to non-ionic detergent extraction of CD20 than the C2B8 antibody (another anti-CD20 antibody with a sequence identical to rituximab (See U.S. Pat. Pub. No.2003 0003097 to Reff)). As expected of atype II anti-CD20 antibody, the humanized B-IyI did not have any significant complement mediated lysis activity and displayed much lower complement mediated lysis activity than the anti-CD20 antibody C2B8 (chimeric IgGl with identical sequence to rituximab). Another important property of the humanized B-IyI antibody (variant B-HH2 B-KVl) was that it was very potent in the homotypic aggregation assay. In this assay CD20-ρositive human cells, Daudi cells, were incubated in cell culture medium for up to 24 hours at 370C in a 5% CO2 atmosphere in a mammalian cell incubator as described in detail in Deans et al., with the antibody at a concentration of 1 microgram per ml and in parallel at a concentration of 5 micrograms per ml. As a comparison, parallel control incubation of the cells was performed under identical conditions using the anti- CD20 antibody, C2B8. At different time points, including 8 hours and 24 hours of incubation, the cells were inspected visually using a microscope. It was found that the humanized B-IyI antibody led to strong homotypic aggregation, with aggregates being significantly larger that those induced by addition of the C2B8 control antibody. In addition, and consistent with the antibody being anti-CD20 type π, it induced higher levels of apoptosis when CD20-positive human cells were incubated with the humanized B-IyI antibody, relative to a control under identical conditions using the C2B8 chimeric IgGl antibody with identical sequence to rituximab. Glycoengineered variants of the humanized antibodies were produced by co-expression of GnTIII glycosyltransferase, together with the antibody genes, in mammalian cells. This led to an increase in the fraction of non-fucosylated oligosaccharides attached to the Fc region of the antibodies, including bisected non-fucosylated oligosaccharides, as has been described in WO 2004/065540 (Figures 17-19). The glycoengineered antibodies had significantly higher levels of binding to human FcgammaRIII receptors (Figure 20) and higher ADCC activity as well (Figure 16), relative to the non-glycoengineered antibody and relative to the C2B8 antibody. The humanized B-IyI antibody was also more potent at inducing human B-cell depletion in a whole blood assay (Figure 16) than the control C2B8 antibody. This was true both for the non-glycoengineered B-IyI antibody and for the glycoengineered version of it. The glycoengineered antibody was approximately 1000-fold more potent than the C2B8 control anti- CD20 antibody in depleting B -cells in the whole blood assay. This comparison is important both for the non-glycoengineered and for the glycoengineered humanized forms of B-IyI antibody, because it showed that in assays that combined Fc receptor-dependent activities, such as ADCC, plus complement mediated lysis, plus induction of apoptosis, that both forms of B-IyI were significantly more potent than C2B8, although both forms of B-IyI have dramatically lower complement mediated lysis activity. The ADCC, Fc receptor- dependent cell killing activities and apoptosis induction were present in this superior activity of the humanized B-IyI antibody variants. Furthermore, in the apoptosis assay, both the glycoengineered andnon-glycoengineered forms of this type II anti-CD20 antibody were potent, with the Fc-engineered variants with increased binding affinity to Fcgamma receptors being even more potent in apoptosis induction than the non-Fc-engineered variant, and with all variants being significantly more potent than the control antibody C2B8. The exact mechanism for enhanced homotypic aggregation and induction of apoptopsis mediated by type II anti-CD20 antibodies is not known and concomitant binding to other molecules on the surface of CD20-positive cells, such as Fc gamma receptors, can influence this important property. It was therefore important to demonstrate that anti-CD20 antibodies of type II that have been engineered in their Fc region for increased binding affinity to Fc gamma receptors, including FcgammaRiπ and with an associated increase in ADCC activity, were still able to induce strong apoptosis, even higher than the non-Fc-engineered, and homotypic aggregation. Apoptopsis induction is important since, in vivo, there are locations in the body where the target CD20-positive cells can be found, but where access to FcgammaRIII-positive cells is more difficult than in blood (for example, lymph nodes). In those locations, the induction of apoptosis by the anti- CD20 antibody, itself, can be crucial for good efficacy of the anti-CD20 antibody therapy in humans, both for the treatment of haematological malignancies such as non-Hodgkins lymphomas and B-cell chronic lymphocytic leukaemia, and for the treatment of autoimmune diseases such as rheumatoid arthritis and lupus via a B- cell depletion approach. The increased binding affinity to FcgammaRIII and higher ADCC of the humanized, Fc-engineered type II anti-CD20 antibody can also be a very important attribute for such therapies. Finally, the reduced or negligible complement mediated lysis activity of this type π anti-CD20 antibody, including humanized and Fc-engineered variants, can also be important, since higher complement activation by anti-CD20 antibodies has been correlated with increased, undesirable side-effects.
EXAMPLE 3
[0337] To further examine residues influencing apoptotic activity, six variants of the BHH2 heavy chain were generated: BHH2-A (VIlL) (SEQ ID NO: 124), BHH2-B (K12V) (SEQ ID NO: 125), BHH2-C (A9G) (SEQ ID NO: 126), BHH2-D (ElOG) (SEQ ID NO: 127), BHH2-E (Tl 101) (SEQ ID NO: 128), and BHH2-F (Sl 121) (SEQ ID NO: 129). These variant constructs were tested for binding to target antigen (CD20) by methods described herein above. AU six variant constructs retained binding activity.
[0338] These heavy chain variant constructs were also tested for apoptotic effect by methods described herein above. Five of the constructs, BHH2-B, BHH2-C, BHH2-D, BHH-2E, and BHH-2F, had the same apoptic potential as the BHH2 parent construct. However, the ability of BHH2-A (VIlL) to induce apoptosis was significantly decreased in comparison to BHH2 {see Figure 23).
[0339] The apoptotic effect of single amino acid subsitutions in the humanized
B-IyI light chain (BKVl) was also examined through the generation of five variants: BKV-10 (P40A) (SEQ ID NO:130), BKV-Il (A80P) (SEQ ED NO:131), BKV-12 (V83F) (SEQ ID NO:132), BKV-13 (E105A) (SEQ ID NO:133), andBKV-14 (Il 06A) (SEQ ID NO: 134). Constructs BKV-Il, BKV- 12, BKV-13, and BKV-14 were tested for binding to target antigen (CD20) by methods described herein above, and it was determined that all four retained binding activity. These four light chain variant constructs were also tested for apoptotic effect by methods described herein above. The apjoptotic potential of BKV-11, BKV-12, and BKV-13 was unchangedby their respective substiutions. However, BKV-14 demonstrated a reduced ability to induce apoptosis in comparison to BKVl {see, e.g., Figure 25).
[0340] All publications such as textbooks, journal articles, GenBank entries, and published applications, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.

Claims

WHAT IS CLAIMED IS :
1. A modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein said substitution results in altered cell signaling activity of a target antigen when said modified antigen binding molecule is complexed with said target antigen.
2. A modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein said modified antigen binding molecule has altered ability to mediate cross- linking of one or more target antigens as a result of said substitution.
3. The modified antigen binding molecule of claim 1 or 2, wherein said substitution is in said heavy chain variable region.
4. The modified antigen binding molecule of claim 3, wherein said substitution is in FRl of said heavy chain variable region.
5. The modified antigen binding molecule of claim 3, wherein the entire FRl of said heavy chain variable region is replaced by a germline VH FRl.
6. The modified antigen binding molecule of claim 5, wherein the germline VH FRl comprises an amino acid sequence at Kabat positions 8 to 13 selected from the group consisting of SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO: 65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ K) NC-.71, SEQ K) NO.72, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, SEQ ID NO.101, SEQ IDNO:102, SEQ ID NO:103, SEQ ID NO:104, and SEQ K) NO:105.
7. The modified antigen binding molecule of claim 4, wherein said substitution in FRl of said heavy chain variable region comprises a replacement of an amino acid residue at one or more of Kabat positions 8, 9, 10, 11, 12, or 13.
8. The modified antigen binding molecule of claim 7, wherein said substitution in FRl of said heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 11.
9. The modified antigen binding molecule of claim 8, wherein said substitution comprises a replacement of the amino acid residue at Kabat position 11 with a valine.
10. The modified antigen binding molecule of claim 7, wherein said substitution in FRl of said heavy chain variable region comprises a replacement of the amino acid residue at Kabat position 12.
11. The modified antigen binding molecule of claim 10, wherein said substitution comprises a replacement of the amino acid residue at Kabat position 12 with a lysine.
12. The modified antigen binding molecule of claim 7, wherein said substitution in FRl of said heavy chain variable region comprises a replacement of the amino acid residues at Kabat positions 11 and 12.
13. The modified antigen binding molecule of claim 12, wherein said substitution comprises a replacement of the amino acid residue at Kabat position 11 with a valine and at Kabat position 12 with a lysine.
14. The modified antigen binding molecule of claim 12, wherein said substitution comprises a replacement of the amino acid residue at Kabat position 11 with a leucine and at Kabat position 12 with a valine.
15. The modified antigen binding molecule of claim 3, wherein said substitution comprises replacement of at least one amino acid residue in FR4 of said heavy chain variable region.
16. The modified antigen binding molecule of claim 15, wherein said substitution in FR4 of said heavy chain variable region comprises a replacement of an amino acid residue at one or more of Kabat positions 110 or 112.
17. The modified antigen binding molecule of claim 1 or 2, wherein said substitution is in said light chain variable region.
18. The modified antigen binding molecule of claim 17, wherein said substitution in said light chain variable region comprises a replacement of an amino acid residue at one or more of Kabat positions 40, 80, 83, 105, or 106.
19. The modified antigen binding molecule of claim 1 , wherein said altered cell signaling activity is increased agonist activity.
20. The modified antigen binding molecule of claim 19, wherein said increased agonist activity is induction of apoptosis.
21. The modified antigen binding molecule of claim 1 , wherein said altered cell signaling activity is increased antagonist activity.
22. The modified antigen binding molecule of claim 1 or 2, wherein said modified antigen binding molecule binds specifically to human CD20.
23. The modified antigen binding molecule of claim 1 or 2, wherein said modified antigen binding molecule binds specifically to a receptor tyrosine kinase.
24. The modified antigen binding molecule of claim 23, wherein said receptor tyrosine kinase is selected from the group consisting of HERl (EGFRl), HER2/neu, HER3, HER4, IGF-IR5 FGFR, PDGFR, VEGFRl5 VEGFR2, and VEGFR3.
25. The modified antigen binding molecule of claim 1 or 2, wherein said parent antigen binding molecule comprises a heavy chain variable region selected from the group consisting of SEQ E) NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:595 SEQ ID NO:60, SEQ ID NO:61, and SEQ ID NO:62.
26. The modified antigen binding molecule of claim 1 or 2, further comprising a human Fc region.
27. The modified antigen binding molecule of claim 26, wherein said Fc region has been modified to have altered oligosaccharides.
28. The modified antigen binding molecule of claim 275 wherein said Fc region has been modified to have a decreased proportion of fucose residues compared to a non-modified Fc region.
29. The modified antigen binding molecule of claim 27, wherein said Fc region has an increased ratio of GIcNAc residues to fucose residues in the modified Fc region compared to a non-modified Fc region.
30. A modified antigen binding molecule comprising a CHl domain comprising at least one amino acid residue substitution as compared to the CHl domain of aparent polypeptide, wherein said substitution results in either altered cell signaling activity of a target antigen when said modified antigen binding molecule is complexed with said target antigen or altered ability to mediate cross-linking of one or more target antigens as a result of said substitution.
31. The modified antigen binding molecule of claim 30, wherein said substitution in CHl comprises a replacement of an amino acid residue at one or more of positions 148, 149 or 150.
32. An isolated polynucleotide encoding a polypeptide comprising a heavy chain or light chain variable region, wherein said heavy chain or light chain variable region comprises at least one amino acid residue substitution in at least one framework region as compared to a parent heavy chain or light chain variable region, and wherein said substitution results in either altered cell signaling activity of a target antigen when said polypeptide is complexed with said target antigen or altered ability to mediate cross-linking of one or more target antigens as a result of said substitution.
33. A vector comprising the polynucleotide of claim 32.
34. A host cell comprising the vector of claim 33.
35. A host cell engineered to express at least one nucleic acid encoding a polypeptide having β(l,4)-N-acetylglucosaminyltransferase IE activity in an amount sufficient to modify the oligosaccharides in the Fc region of a polypeptide produced by said host cell, wherein said polypeptide is a modified antigen binding molecule according to claim 1 or 2.
36. The host cell of claim 35, wherein said antigen binding molecule produced by said host cell exhibits increased effector function as a result of said oligosaccharide modification.
37. A host cell according to claim 36, wherein said increased effector function is increased Fc-mediated cellular cytotoxicity.
38. A host cell according to claim 37, wherein said increased effector function is increased direct signaling inducing apoptosis.
39. A method for producing a modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein said substitution results in altered cell signaling activity of a target antigen when said modified antigen binding molecule is complexed with said target antigen, said method comprising: '
(i) culturing the host cell of claim 34 under conditions permitting the expression of said polynucleotide; and (ii) recovering said modified antigen binding molecule from the culture medium.
40. A method for producing a modified antigen binding molecule comprising a heavy chain or light chain variable region comprising at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, wherein said substitution results in altered ability to mediate cross-linking as a result of said substitution, said method comprising: (i) culturing the host cell of claim 34 under conditions permitting the expression of said polynucleotide; and (ii) recovering said modified antigen binding molecule from the culture medium.
41. A pharmaceutical composition comprising the modified antigen binding molecule of any one of claims 1, 2, or 30 and a pharmaceutically acceptable carrier.
42. Use of the antigen binding molecule according to claim 1 or 2 for the manufacture of a medicament for the treatment or prophylaxis of cancer or a precancerous condition or lesion.
43. The use according to claim 42, wherein said cancer is selected from the group consisting of B-cell lymphoma, breast cancer, bladder cancer, head and neck cancer, skin cancer, pancreatic cancer, lung cancer, ovarian cancer, colon cancer, prostate cancer, kidney cancer, and brain cancer.
44. The use according to claim 42, wherein said precancerous condition or lesion is selected from the group consisting of oral leukoplakia, actinic keratosis (solar keratosis), precancerous polyps of the colon or rectum, gastric epithelial dysplasia, adenomatous dysplasia, hereditary nonpolyposis colon cancer syndrome (HNPCC), Barrett's esophagus, bladder dysplasia, and precancerous cervical conditions.
45. The use according to claim 42, wherein said antigen binding molecule is used in a therapeutically effective amount from about 1.0 mg/kg to about 15 mg/kg.
46. A modified antigen binding molecule according to claim 1 or 2 for use as a medicament in the treatment or prophylaxis of a disorder that is related to altered cell signaling activity and/or altered cross-linking of one or more target antigens.
47. The modified antigen binding molecule according to claim 46, wherein said altered cell signaling activity is increased apoptosis.
48. The modified antigen binding molecule according to claim 46, wherein said disorder is a B cell disorder.
49. The modified antigen binding molecule according to claim 46, wherein said target antigen is CD20.
50. Use of a modified antigen binding molecule comprising a heavy chain or light chain variable region for the preparation of a medicament for inducing apoptosis in a cell, wherein said heavy chain or light chain variable region comprises at least one amino acid residue substitution in at least one framework region of said heavy chain or light chain variable region as compared to the heavy chain or light chain variable region of a parent antigen binding molecule, and wherein said modified antigen binding molecule has increased ability to induce apoptosis compared to said parent polypeptide.
51. Use of a modified antigen binding molecule for the preparation of a medicament for the treatment of a disease or disorder that is treatable by altered cell signaling activity of a target antigen, wherein said modified antigen binding molecule comprises a heavy chain or light chain variable region comprising at least one amino acid substitution in at least one framework region of said heavy chain or light chain variable region compared to the heavy chain or light chain variable region of a parent antigen binding molecule, and wherein said substitution results in altered cell signaling activity of a target antigen when said modified antigen binding molecule is complexed with said target antigen.
52. The use of claim 51, wherein said altered cell signaling activity is increased induction of apoptosis.
53. Use of a modified antigen binding molecule for the preparation of a medicament for the treatment of a disease or disorder that is treatable by altered ability to mediate cross-linking of one or more target antigens, wherein said modified antigen binding molecule comprises a heavy chain or light chain variable region comprising at least one amino acid substitution in at least one framework region of said heavy chain or light chain variable region compared to the heavy chain or light chain variable region of a parent antigen binding molecule, and wherein said modified antigen binding molecule has altered ability to mediate cross-linking of one or more target antigens as a result of said substitution.
54. The use of claim 51 or 53, wherein said modified antigen binding molecule comprises said heavy chain variable region.
55. The use of claim 54, wherein said modified antigen binding molecule comprises a heavy chain variable region selected from the group consisting of SEQ ID NO:4, SEQ ID NO:36, and SEQ ID NO.38.
56. The use of claim 51 or 53, wherein said disease or disorder is a cell proliferation disorder.
57. The use of claim 56, wherein said cell proliferation disorder is cancer.
58. The use of claim 57, wherein said cancer is a B cell lymphoma.
PCT/IB2006/003294 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity WO2007031875A2 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
KR1020087007364A KR101379568B1 (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
CA2619298A CA2619298C (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
EP11163025.7A EP2395024B1 (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
KR1020137024997A KR101460932B1 (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
CN2006800388491A CN101291954B (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
AU2006290433A AU2006290433B2 (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
EP06831581.1A EP1931712B1 (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
BRPI0615397-6A BRPI0615397B1 (en) 2005-08-26 2006-08-25 ANTI-CD20 ANTIBODY, PHARMACEUTICAL COMPOSITION CONTAINING IT AND USE THEREOF
BR122020020335-8A BR122020020335B1 (en) 2005-08-26 2006-08-25 ANTI-CD20 ANTIBODY, PHARMACEUTICAL COMPOSITION AND USE
JP2008527537A JP5373396B2 (en) 2005-08-26 2006-08-25 Modified antigen-binding molecule with modified cell signaling activity
EP11163023.2A EP2395023B1 (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity
RU2008111068/10A RU2482132C2 (en) 2005-08-26 2006-08-25 Modified antigen-binding molecules with changed cell signal activity
NO20081328A NO345919B1 (en) 2005-08-26 2006-08-25 Modified antigen-binding molecules with altered cell signaling activity
IL189756A IL189756A (en) 2005-08-26 2008-02-25 Modified anti-cd20 antibodies that induce high level of apoptosis when complexed with cd20 and uses thereof
ZA2008/02500A ZA200802500B (en) 2005-08-26 2008-03-18 Modified antigen binding molecules with altered cell signaling activity
PH12012502376A PH12012502376B1 (en) 2005-08-26 2012-11-29 Modified antigen binding molecules with altered cell signaling activity
NO20210557A NO20210557A1 (en) 2005-08-26 2021-05-04 Modified antigen-binding molecules with altered cell signaling activity

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US71145405P 2005-08-26 2005-08-26
US60/711,454 2005-08-26

Publications (2)

Publication Number Publication Date
WO2007031875A2 true WO2007031875A2 (en) 2007-03-22
WO2007031875A3 WO2007031875A3 (en) 2008-02-14

Family

ID=37865318

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2006/003294 WO2007031875A2 (en) 2005-08-26 2006-08-25 Modified antigen binding molecules with altered cell signaling activity

Country Status (19)

Country Link
US (2) US20070071745A1 (en)
EP (3) EP1931712B1 (en)
JP (3) JP5373396B2 (en)
KR (2) KR101460932B1 (en)
CN (2) CN103204935B (en)
AR (1) AR055137A1 (en)
AU (1) AU2006290433B2 (en)
BR (2) BRPI0615397B1 (en)
CA (1) CA2619298C (en)
CL (2) CL2010000822A1 (en)
HK (1) HK1185357A1 (en)
IL (1) IL189756A (en)
NO (2) NO345919B1 (en)
PH (1) PH12012502376B1 (en)
RU (2) RU2482132C2 (en)
SG (1) SG192479A1 (en)
TW (2) TWI615407B (en)
WO (1) WO2007031875A2 (en)
ZA (1) ZA200802500B (en)

Cited By (86)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008017963A3 (en) * 2006-08-09 2008-11-06 Glycart Biotechnology Ag Antigen binding molecules that bind egfr, vectors encoding same, and uses thereof
WO2009030368A1 (en) 2007-09-05 2009-03-12 F. Hoffmann-La Roche Ag Combination therapy with type i and type ii anti-cd20 antibodies
WO2009118142A1 (en) * 2008-03-25 2009-10-01 F. Hoffmann-La Roche Ag Use of a type ii anti-cd20 antibody with increased antibody dependent cellular cytotoxicity (adcc) in combination with cyclophosphamide, vincristine and doxorubicine for treating non-hodgkin' s lymphomas
WO2009086072A3 (en) * 2007-12-21 2009-11-05 Genentech, Inc. Therapy of rituximab-refractory rheumatoid arthritis patients
US7638605B2 (en) 2003-05-01 2009-12-29 ImClone, LLC Fully human antibodies directed against the human insulin-like growth factor-1 receptor
US7722867B2 (en) 2005-02-07 2010-05-25 Glycart Biotechnology Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
WO2010115554A1 (en) 2009-03-31 2010-10-14 Roche Glycart Ag Combination therapy of an afucosylated antibody and one or more of the cytokines selected from human gm-csf, human m-csf and/or human il-3
WO2010115552A1 (en) 2009-04-07 2010-10-14 Roche Glycart Ag Bispecific anti-erbb-3/anti-c-met antibodies
WO2010115551A1 (en) 2009-04-07 2010-10-14 Roche Glycart Ag Bispecific anti-erbb-1/anti-c-met antibodies
JP2011500741A (en) * 2007-10-24 2011-01-06 ロシュ グリクアート アクチェンゲゼルシャフト Combination therapy of type II anti-CD20 antibody and proteasome inhibitor
WO2011018224A1 (en) 2009-08-14 2011-02-17 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with bendamustine
WO2011018225A1 (en) 2009-08-14 2011-02-17 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with fludarabine and/or mitoxantrone
WO2011023389A1 (en) 2009-08-28 2011-03-03 Roche Glycart Ag Humanized anti-cdcp1 antibodies
WO2011023390A1 (en) 2009-08-28 2011-03-03 F. Hoffmann-La Roche Ag Antibodies against cdcp1 for the treatment of cancer
WO2011076683A1 (en) 2009-12-22 2011-06-30 Roche Glycart Ag Anti-her3 antibodies and uses thereof
US7972600B2 (en) 2006-02-03 2011-07-05 Imclone Llc IGF-IR antagonists as adjuvants for treatment of prostate cancer
WO2011117330A1 (en) 2010-03-26 2011-09-29 Roche Glycart Ag Bispecific antibodies
WO2011134899A1 (en) 2010-04-27 2011-11-03 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with a mtor inhibitor
WO2012018771A1 (en) 2010-08-03 2012-02-09 Genentech, Inc. Chronic lymphocytic leukemia (cll) biomarkers
WO2012022747A1 (en) 2010-08-17 2012-02-23 F. Hoffmann-La Roche Ag Combination therapy of an afucosylated cd20 antibody with an anti-vegf antibody
WO2012025530A1 (en) 2010-08-24 2012-03-01 F. Hoffmann-La Roche Ag Bispecific antibodies comprising a disulfide stabilized - fv fragment
US8128929B2 (en) 2005-06-17 2012-03-06 Imclone Llc Antibodies against PDGFRa
WO2012080389A1 (en) 2010-12-16 2012-06-21 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with a mdm2 inhibitor
WO2012116926A1 (en) 2011-02-28 2012-09-07 F. Hoffmann-La Roche Ag Antigen binding proteins
WO2012116927A1 (en) 2011-02-28 2012-09-07 F. Hoffmann-La Roche Ag Monovalent antigen binding proteins
WO2013041462A1 (en) 2011-09-23 2013-03-28 Roche Glycart Ag Bispecific anti-egfr/anti igf-1r antibodies
WO2013076183A1 (en) 2011-11-25 2013-05-30 Roche Glycart Ag Combination therapy using anti - cd20 antibody and human il-15
EP2604277A1 (en) 2007-10-15 2013-06-19 Roche Glycart AG Combination therapy of a type II anti-CD20 antibody with an anti-Bcl-2 active agent
EP2727941A1 (en) 2012-11-05 2014-05-07 MAB Discovery GmbH Method for the production of multispecific antibodies
EP2727943A1 (en) 2012-11-05 2014-05-07 MAB Discovery GmbH Trispecific antibodies against human EGFR, HER2 and HER3
EP2727942A1 (en) 2012-11-05 2014-05-07 MAB Discovery GmbH Bispecific antibodies against human EGFR, HER2, and HER3
WO2014067642A1 (en) 2012-11-05 2014-05-08 Mab Discovery Gmbh Method for the production of multispecific antibodies
WO2014108484A2 (en) 2013-01-11 2014-07-17 F. Hoffmann-La Roche Ag Combination therapy of anti-her3 antibodies
EP2762496A1 (en) 2013-02-05 2014-08-06 EngMab AG Method for the selection of antibodies against BCMA
WO2014122143A1 (en) 2013-02-05 2014-08-14 Engmab Ag Method for the selection of antibodies against bcma
WO2014160490A1 (en) 2013-03-13 2014-10-02 Genetech, Inc. Antibody formulations
US8883980B2 (en) 2003-11-05 2014-11-11 Roche Glycart Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2015082446A1 (en) 2013-12-02 2015-06-11 F. Hoffmann-La Roche Ag Treatment of cancer using an anti-cdcp1 antibody and a taxane
WO2015095410A1 (en) 2013-12-17 2015-06-25 Genentech, Inc. Methods of treating cancer using pd-1 axis binding antagonists and an anti-cd20 antibody
US9085622B2 (en) 2010-09-03 2015-07-21 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins
US9266967B2 (en) 2007-12-21 2016-02-23 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
EP2158315B1 (en) 2007-06-25 2016-03-23 ESBATech, an Alcon Biomedical Research Unit LLC Methods of modifying antibodies, and modified antibodies with improved functional properties
US9382323B2 (en) 2009-04-02 2016-07-05 Roche Glycart Ag Multispecific antibodies comprising full length antibodies and single chain fab fragments
WO2016183104A1 (en) * 2015-05-11 2016-11-17 Genentech, Inc. Compositions and methods of treating lupus nephritis
EP3108897A1 (en) 2015-06-24 2016-12-28 F. Hoffmann-La Roche AG Antibodies against human csf-1r for use in inducing lymphocytosis in lymphomas or leukemias
WO2016207304A2 (en) 2015-06-26 2016-12-29 Mab Discovery Gmbh Monoclonal anti-il-1racp antibodies
WO2017004091A1 (en) 2015-06-29 2017-01-05 Genentech, Inc. Type ii anti-cd20 antibody for use in organ transplantation
US9676845B2 (en) 2009-06-16 2017-06-13 Hoffmann-La Roche, Inc. Bispecific antigen binding proteins
EP3178848A1 (en) 2015-12-09 2017-06-14 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody for reducing formation of anti-drug antibodies
US9688758B2 (en) 2012-02-10 2017-06-27 Genentech, Inc. Single-chain antibodies and other heteromultimers
WO2017148879A1 (en) 2016-03-01 2017-09-08 F. Hoffmann-La Roche Ag Obinutuzumab and rituximab variants having reduced adcp
EP3252078A1 (en) 2016-06-02 2017-12-06 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
EP3257866A1 (en) 2016-06-17 2017-12-20 Academisch Medisch Centrum Modified anti-tnf antibody and use thereof in the treatment of ibd
US9890204B2 (en) 2009-04-07 2018-02-13 Hoffmann-La Roche Inc. Trivalent, bispecific antibodies
WO2018083204A1 (en) 2016-11-02 2018-05-11 Engmab Sàrl Bispecific antibody against bcma and cd3 and an immunological drug for combined use in treating multiple myeloma
US9994646B2 (en) 2009-09-16 2018-06-12 Genentech, Inc. Coiled coil and/or tether containing protein complexes and uses thereof
WO2018114748A1 (en) 2016-12-20 2018-06-28 F. Hoffmann-La Roche Ag Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists
US10106612B2 (en) 2012-06-27 2018-10-23 Hoffmann-La Roche Inc. Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof
US10138293B2 (en) 2007-12-21 2018-11-27 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
WO2018220099A1 (en) 2017-06-02 2018-12-06 F. Hoffmann-La Roche Ag Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
WO2019020606A1 (en) 2017-07-26 2019-01-31 F. Hoffmann-La Roche Ag Combination therapy with a bet inhibitor, a bcl-2 inhibitor and an anti-cd20 antibody
US10280227B2 (en) 2009-09-11 2019-05-07 Genentech, Inc. Highly concentrated pharmaceutical formulations
US10323099B2 (en) 2013-10-11 2019-06-18 Hoffmann-La Roche Inc. Multispecific domain exchanged common variable light chain antibodies
WO2019175071A1 (en) 2018-03-13 2019-09-19 F. Hoffmann-La Roche Ag Therapeutic combination of 4-1 bb agonists with anti-cd20 antibodies
EP3613433A1 (en) 2014-05-30 2020-02-26 Henlix Biotech Co., Ltd. Anti-epidermal growth factor receptor (egfr) antibodies
US10633457B2 (en) 2014-12-03 2020-04-28 Hoffmann-La Roche Inc. Multispecific antibodies
WO2020117257A1 (en) 2018-12-06 2020-06-11 Genentech, Inc. Combination therapy of diffuse large b-cell lymphoma comprising an anti-cd79b immunoconjugates, an alkylating agent and an anti-cd20 antibody
EP3670535A1 (en) 2015-08-03 2020-06-24 EngMab Sàrl Monoclonal antibodies against bcma
EP3689910A2 (en) 2014-09-23 2020-08-05 F. Hoffmann-La Roche AG Method of using anti-cd79b immunoconjugates
WO2020232169A1 (en) 2019-05-14 2020-11-19 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat follicular lymphoma
WO2021050645A1 (en) 2019-09-12 2021-03-18 Genentech, Inc. Compositions and methods of treating lupus nephritis
WO2021076196A1 (en) 2019-10-18 2021-04-22 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma
WO2021217051A1 (en) 2020-04-24 2021-10-28 Genentech, Inc. Methods of using anti-cd79b immunoconjugates
US11203642B2 (en) 2016-05-06 2021-12-21 Sanofi Biotechnology SAS Humanized anti-IL-1R3 antibodies
US11286300B2 (en) 2015-10-01 2022-03-29 Hoffmann-La Roche Inc. Humanized anti-human CD19 antibodies and methods of use
US11370833B2 (en) 2014-09-15 2022-06-28 Genentech, Inc. Antibody formulations
EP4026848A1 (en) 2015-12-09 2022-07-13 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody for reducing the cytokine release syndrome
WO2022148732A1 (en) 2021-01-06 2022-07-14 F. Hoffmann-La Roche Ag Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody
US11421022B2 (en) 2012-06-27 2022-08-23 Hoffmann-La Roche Inc. Method for making antibody Fc-region conjugates comprising at least one binding entity that specifically binds to a target and uses thereof
WO2022198192A1 (en) 2021-03-15 2022-09-22 Genentech, Inc. Compositions and methods of treating lupus nephritis
WO2022241446A1 (en) 2021-05-12 2022-11-17 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma
WO2023019092A1 (en) 2021-08-07 2023-02-16 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma
US11618790B2 (en) 2010-12-23 2023-04-04 Hoffmann-La Roche Inc. Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery
US11639392B2 (en) 2017-05-08 2023-05-02 Sanofi Biotechnology Anti-IL-1R3 antibodies for use in inflammatory conditions
US11859003B2 (en) 2017-08-21 2024-01-02 Adagene Inc. Method for treating cancer using anti-CD137 antibody
US11952681B2 (en) 2018-02-02 2024-04-09 Adagene Inc. Masked activatable CD137 antibodies

Families Citing this family (35)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
NZ571596A (en) 2001-08-03 2010-11-26 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
KR101460932B1 (en) * 2005-08-26 2014-11-12 로슈 글리카트 아게 Modified antigen binding molecules with altered cell signaling activity
CA2718191C (en) * 2008-03-13 2018-05-15 Biotest Ag Agent for treating disease
SG190627A1 (en) * 2008-03-13 2013-06-28 Biotest Ag Agent for treating disease
JP5597553B2 (en) * 2008-03-13 2014-10-01 バイオテスト・アクチエンゲゼルシヤフト Disease treatment agent
SG190572A1 (en) * 2008-04-29 2013-06-28 Abbott Lab Dual variable domain immunoglobulins and uses thereof
US20100260668A1 (en) * 2008-04-29 2010-10-14 Abbott Laboratories Dual Variable Domain Immunoglobulins and Uses Thereof
WO2009149185A2 (en) * 2008-06-03 2009-12-10 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
CA2726087A1 (en) * 2008-06-03 2009-12-10 Tariq Ghayur Dual variable domain immunoglobulins and uses thereof
WO2010006060A2 (en) * 2008-07-08 2010-01-14 Abbott Laboratories Prostaglandin e2 dual variable domain immunoglobulins and uses thereof
AU2009296078B2 (en) * 2008-09-29 2015-08-20 Biotest Ag Composition for treating disease
US8815242B2 (en) * 2009-05-27 2014-08-26 Synageva Biopharma Corp. Avian derived antibodies
UY32808A (en) * 2009-07-29 2011-02-28 Abbott Lab IMMUNOGLOBULINS AS A DUAL VARIABLE DOMAIN AND USES OF THE SAME
CA2772628A1 (en) * 2009-09-01 2011-03-10 Abbott Laboratories Dual variable domain immunoglobulins and uses thereof
PE20121531A1 (en) * 2009-10-15 2012-12-22 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN
UY32979A (en) 2009-10-28 2011-02-28 Abbott Lab IMMUNOGLOBULINS WITH DUAL VARIABLE DOMAIN AND USES OF THE SAME
GB0920944D0 (en) 2009-11-30 2010-01-13 Biotest Ag Agents for treating disease
US8735546B2 (en) 2010-08-03 2014-05-27 Abbvie Inc. Dual variable domain immunoglobulins and uses thereof
EP2608803A4 (en) 2010-08-26 2014-01-15 Abbvie Inc Dual variable domain immunoglobulins and uses thereof
KR102239138B1 (en) * 2011-09-30 2021-04-12 추가이 세이야쿠 가부시키가이샤 Antigen-binding molecule inducing immune response to target antigen
JP2015508994A (en) 2011-12-30 2015-03-26 アッヴィ・インコーポレイテッド Dual variable domain immunoglobulins against IL-13 and / or IL-17
AU2013337775B2 (en) 2012-11-01 2017-03-30 Abbvie Inc. Anti-VEGF/DLL4 dual variable domain immunoglobulins and uses thereof
JP2016522793A (en) 2013-03-15 2016-08-04 アッヴィ・インコーポレイテッド Bispecific binding protein directed against IL-1β and / or IL-17
US20170313779A1 (en) * 2014-11-05 2017-11-02 The University Of Chicago Methods and compositions pertaining to human cerebral cavernous malformations
WO2016094881A2 (en) 2014-12-11 2016-06-16 Abbvie Inc. Lrp-8 binding proteins
TW201710286A (en) 2015-06-15 2017-03-16 艾伯維有限公司 Binding proteins against VEGF, PDGF, and/or their receptors
PE20181050A1 (en) * 2015-06-24 2018-07-03 Hoffmann La Roche ANTIBODIES AGAINST HUMAN CSF-1R FOR USE IN THE INDUCTION OF LYMPHOCYTOSIS IN LYMPHOMAS OR LEUKEMIAS
IL262061B2 (en) * 2016-04-01 2023-03-01 Amgen Inc Chimeric receptors to flt3 and methods of use thereof
US11649284B2 (en) 2016-04-18 2023-05-16 Baylor College Of Medicine Cancer gene therapy targeting CD47
US10148939B2 (en) 2016-07-19 2018-12-04 Gopro, Inc. Mapping of spherical image data into rectangular faces for transport and decoding across networks
KR20200040819A (en) * 2017-08-16 2020-04-20 브리스톨-마이어스 스큅 컴퍼니 Anti-CTLA-4 probody treatment for targeting antibodies
US20220009959A1 (en) * 2018-11-26 2022-01-13 North Carolina State University Peptide ligands for capture of host cell proteins
JP7446342B2 (en) * 2019-06-19 2024-03-08 エフ． ホフマン－ラ ロシュ アーゲー Method for generating cells expressing trivalent antibodies by targeted incorporation of multiple expression cassettes in a predetermined configuration
WO2021022113A1 (en) * 2019-07-31 2021-02-04 The Wistar Institute Of Anatomy And Biology Multivalent dna antibody constructs and use thereof
CN111411079A (en) * 2020-03-27 2020-07-14 北京时合生物科技有限公司 Cell culture method, modified antibody, cell culture medium, cell product and application thereof

Citations (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997017446A2 (en) * 1995-11-07 1997-05-15 Idec Pharmaceutical Corporation HUMANIZED ANTIBODIES TO HUMAN gp39, COMPOSITIONS CONTAINING AND THERAPEUTIC USE THEREOF
WO2003024388A2 (en) * 2001-09-20 2003-03-27 Cornell Research Foundation, Inc. Methods and compositions for treating and preventing skin disorders using binding agents specific for psma
US20030129185A1 (en) * 1996-10-04 2003-07-10 Koichiro Ono Reshaped human anti-HM 1.24 antibody
US20040202655A1 (en) * 2003-03-14 2004-10-14 Morton Phillip A. Antibodies to IGF-I receptor for the treatment of cancers
US20040229310A1 (en) * 2003-01-23 2004-11-18 Genentech, Inc. Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture
US20050042664A1 (en) * 2003-08-22 2005-02-24 Medimmune, Inc. Humanization of antibodies
US20050058649A1 (en) * 2002-12-02 2005-03-17 Landes Gregory M. Antibodies directed to phospholipase A2 and uses thereof
WO2005044859A2 (en) * 2003-11-05 2005-05-19 Glycart Biotechnology Ag Cd20 antibodies with increased fc receptor binding affinity and effector function
WO2005062955A2 (en) * 2003-12-23 2005-07-14 Rinat Neuroscience Corp. Agonist anti-trkc antibodies and methods using same
WO2005079479A2 (en) * 2004-02-17 2005-09-01 Absalus, Inc. Super-humanized antibodies against respiratory syncytial virus
US20060057149A1 (en) * 2004-09-13 2006-03-16 Johnson Leslie S Humanized antibodies against West Nile Virus and therapeutic and prophylactic uses thereof
US20060073148A1 (en) * 2004-06-17 2006-04-06 Wyeth IL-13 binding agents
WO2006066089A1 (en) * 2004-12-15 2006-06-22 Neuralab Limited Humanized amyloid beta antibodies for use in improving cognition

Family Cites Families (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0173494A3 (en) 1984-08-27 1987-11-25 The Board Of Trustees Of The Leland Stanford Junior University Chimeric receptors by dna splicing and expression
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
IL85035A0 (en) 1987-01-08 1988-06-30 Int Genetic Eng Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
SI1516628T1 (en) 1995-07-27 2013-10-30 Genentech, Inc. Stable isotonic lyophilized protein formulation
CA2292730C (en) 1997-06-13 2008-09-16 Genentech, Inc. Stabilized antibody formulation
TR200002885T2 (en) * 1998-04-03 2000-12-21 Chugai Seiyaku Kabushiki Kaisha Humanized antibody against human tissue factor (TF)
ATE458007T1 (en) * 1998-04-20 2010-03-15 Glycart Biotechnology Ag GLYCOSYLATION ENGINEERING OF ANTIBODIES TO IMPROVE ANTIBODIES-DEPENDENT CELL-MEDIATED CYTOTOXICITY
ATE428732T1 (en) * 1998-05-20 2009-05-15 Kyowa Hakko Kogyo Kk GENE RECOMBINANT ANTIBODIES
AU3041100A (en) * 1999-01-05 2000-07-24 Unilever Plc Binding of antibody fragments to solid supports
US6737056B1 (en) * 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
EP2386574A3 (en) 1999-01-15 2012-06-27 Genentech, Inc. Polypeptide variants with altered effector function
EP3031917A1 (en) 1999-04-09 2016-06-15 Kyowa Hakko Kirin Co., Ltd. Method for controlling the activity of immunologically functional molecule
AU2001288226B2 (en) 2000-07-31 2007-07-26 Synthon Biopharmaceuticals B.V. Expression of biologically active polypeptides in duckweed
WO2002034790A1 (en) * 2000-10-20 2002-05-02 Idec Pharmaceuticals Corporation Variant igg3 rituxan r and therapeutic use thereof
RU2306952C2 (en) * 2001-01-31 2007-09-27 Байоджен Айдек Инк. Method for treating the cases of malignant tumors containing b-cells with a combination of applications related to antibodies reducing b-cells number and with immunomodulating antibodies
WO2002079255A1 (en) * 2001-04-02 2002-10-10 Idec Pharmaceuticals Corporation RECOMBINANT ANTIBODIES COEXPRESSED WITH GnTIII
US7321026B2 (en) 2001-06-27 2008-01-22 Skytech Technology Limited Framework-patched immunoglobulins
WO2004006955A1 (en) 2001-07-12 2004-01-22 Jefferson Foote Super humanized antibodies
NZ571596A (en) * 2001-08-03 2010-11-26 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
EP1467615B2 (en) 2001-12-27 2017-03-22 GlycoFi, Inc. Methods to engineer mammalian-type carbohydrate structures
CN100522999C (en) * 2002-02-14 2009-08-05 免疫医疗公司 Anti-CD20 antibodies and fusion proteins thereof and methods of use
US7432063B2 (en) 2002-02-14 2008-10-07 Kalobios Pharmaceuticals, Inc. Methods for affinity maturation
US20040132101A1 (en) 2002-09-27 2004-07-08 Xencor Optimized Fc variants and methods for their generation
NZ534881A (en) 2002-03-19 2006-09-29 Plant Res Internat B Mammalian GnTIII expression in plants
PT1490405E (en) * 2002-03-21 2007-11-07 Lilly Co Eli Antagonistic anti-hfas ligand human antibodies and fragments thereof
US20030190689A1 (en) * 2002-04-05 2003-10-09 Cell Signaling Technology,Inc. Molecular profiling of disease and therapeutic response using phospho-specific antibodies
US20040132097A1 (en) 2002-06-19 2004-07-08 Bacus Sarah S. Method for predicting response to epidermal growth factor receptor-directed therapy
JP4459810B2 (en) 2002-08-14 2010-04-28 マクロジェニクス，インコーポレーテッド FcγRIIB specific antibody and method of use thereof
EP1539966B1 (en) 2002-09-12 2010-06-30 Greenovation Biotech GmbH Protein production method
CA2549932C (en) 2002-12-20 2013-08-20 Greenovation Biotech Gmbh Production of heterologous glycosylated proteins in bryophyte cells
JP2006524039A (en) * 2003-01-09 2006-10-26 マクロジェニクス，インコーポレーテッド Identification and production of antibody containing mutant Fc region and use thereof
US7960512B2 (en) * 2003-01-09 2011-06-14 Macrogenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
CN103540600B (en) 2003-01-22 2017-12-01 罗氏格黎卡特股份公司 Fusion constructs and its for producing the purposes for the antibody that Fc receptor binding affinities and effector function improve
BRPI0411276A (en) * 2003-06-05 2006-08-01 Genentech Inc B-cell depletion methods, B-cell neoplasm or malignancy treatment method, B-cell-regulated autoimmune dysfunction relief method, composition and industrialized article
CA2608818A1 (en) * 2005-06-03 2006-12-14 Genentech, Inc. Method of producing antibodies with modified fucosylation level
KR101460932B1 (en) * 2005-08-26 2014-11-12 로슈 글리카트 아게 Modified antigen binding molecules with altered cell signaling activity

Patent Citations (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997017446A2 (en) * 1995-11-07 1997-05-15 Idec Pharmaceutical Corporation HUMANIZED ANTIBODIES TO HUMAN gp39, COMPOSITIONS CONTAINING AND THERAPEUTIC USE THEREOF
US20030129185A1 (en) * 1996-10-04 2003-07-10 Koichiro Ono Reshaped human anti-HM 1.24 antibody
WO2003024388A2 (en) * 2001-09-20 2003-03-27 Cornell Research Foundation, Inc. Methods and compositions for treating and preventing skin disorders using binding agents specific for psma
US20030161832A1 (en) * 2001-09-20 2003-08-28 Neil Bander Methods and compositions for treating or preventing skin disorders using binding agents specific for prostate specific membrane antigen
US20050058649A1 (en) * 2002-12-02 2005-03-17 Landes Gregory M. Antibodies directed to phospholipase A2 and uses thereof
US20040229310A1 (en) * 2003-01-23 2004-11-18 Genentech, Inc. Methods for producing humanized antibodies and improving yield of antibodies or antigen binding fragments in cell culture
US20040202655A1 (en) * 2003-03-14 2004-10-14 Morton Phillip A. Antibodies to IGF-I receptor for the treatment of cancers
US20050042664A1 (en) * 2003-08-22 2005-02-24 Medimmune, Inc. Humanization of antibodies
WO2005044859A2 (en) * 2003-11-05 2005-05-19 Glycart Biotechnology Ag Cd20 antibodies with increased fc receptor binding affinity and effector function
WO2005062955A2 (en) * 2003-12-23 2005-07-14 Rinat Neuroscience Corp. Agonist anti-trkc antibodies and methods using same
WO2005079479A2 (en) * 2004-02-17 2005-09-01 Absalus, Inc. Super-humanized antibodies against respiratory syncytial virus
US20060073148A1 (en) * 2004-06-17 2006-04-06 Wyeth IL-13 binding agents
US20060057149A1 (en) * 2004-09-13 2006-03-16 Johnson Leslie S Humanized antibodies against West Nile Virus and therapeutic and prophylactic uses thereof
WO2006066089A1 (en) * 2004-12-15 2006-06-22 Neuralab Limited Humanized amyloid beta antibodies for use in improving cognition

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
CORTI A ET AL: "IDIOTOPE DETERMINING REGIONS OF A MOUSE MONOCLONAL ANTIBODY AND ITSHUMANIZED VERSIONS IDENTIFICATION OF FRAMEWORK RESIDUES THAT AFFECT IDIOTYPE EXPRESSION" JOURNAL OF MOLECULAR BIOLOGY, LONDON, GB, vol. 235, no. 1, January 1994 (1994-01), pages 53-60, XP000564648 ISSN: 0022-2836 *
FAN Z C ET AL: "Comparison of the three-dimensional structures of a humanized and a chimeric Fab of an anti-gamma-interferon antibody." JOURNAL OF MOLECULAR RECOGNITION : JMR 1999 JAN-FEB, vol. 12, no. 1, January 1999 (1999-01), pages 19-32, XP002455649 ISSN: 0952-3499 *
NESHAT M N ET AL: "Mapping the B cell superantigen binding site for HIV-1 gp120 on a V(H)3 Ig." INTERNATIONAL IMMUNOLOGY MAR 2000, vol. 12, no. 3, March 2000 (2000-03), pages 305-312, XP002455647 ISSN: 0953-8178 *
POTTER KATHLEEN N ET AL: "Evidence for involvement of a hydrophobic patch in framework region 1 of human V4-34-encoded Igs in recognition of the red blood cell I antigen." JOURNAL OF IMMUNOLOGY (BALTIMORE, MD. : 1950) 1 OCT 2002, vol. 169, no. 7, 1 October 2002 (2002-10-01), pages 3777-3782, XP002455648 ISSN: 0022-1767 *

Cited By (147)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7638605B2 (en) 2003-05-01 2009-12-29 ImClone, LLC Fully human antibodies directed against the human insulin-like growth factor-1 receptor
US7968093B2 (en) 2003-05-01 2011-06-28 Imclone Llc Fully human antibodies directed against the human insulin-like growth factor-1 receptor
US8883980B2 (en) 2003-11-05 2014-11-11 Roche Glycart Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
US9296820B2 (en) 2003-11-05 2016-03-29 Roche Glycart Ag Polynucleotides encoding anti-CD20 antigen binding molecules with increased Fc receptor binding affinity and effector function
US7846432B2 (en) 2005-02-07 2010-12-07 Glycart Biotechnology Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US8614065B2 (en) 2005-02-07 2013-12-24 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US9309317B2 (en) 2005-02-07 2016-04-12 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US7722867B2 (en) 2005-02-07 2010-05-25 Glycart Biotechnology Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US8097436B2 (en) 2005-02-07 2012-01-17 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US9957326B2 (en) 2005-02-07 2018-05-01 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US8128929B2 (en) 2005-06-17 2012-03-06 Imclone Llc Antibodies against PDGFRa
US7972600B2 (en) 2006-02-03 2011-07-05 Imclone Llc IGF-IR antagonists as adjuvants for treatment of prostate cancer
EP2444422A3 (en) * 2006-08-09 2012-07-18 GlycArt Biotechnology AG Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US7727741B2 (en) 2006-08-09 2010-06-01 Glycart Biotechnology Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US7662377B2 (en) 2006-08-09 2010-02-16 Glycart Biotechnology Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US8088380B2 (en) 2006-08-09 2012-01-03 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
WO2008017963A3 (en) * 2006-08-09 2008-11-06 Glycart Biotechnology Ag Antigen binding molecules that bind egfr, vectors encoding same, and uses thereof
US9074008B2 (en) 2006-08-09 2015-07-07 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
AU2007282923B2 (en) * 2006-08-09 2012-09-13 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
US8273328B2 (en) 2006-08-09 2012-09-25 Roche Glycart Ag Antigen binding molecules that bind EGFR, vectors encoding same, and uses thereof
EP2158315B1 (en) 2007-06-25 2016-03-23 ESBATech, an Alcon Biomedical Research Unit LLC Methods of modifying antibodies, and modified antibodies with improved functional properties
JP2010538024A (en) * 2007-09-05 2010-12-09 エフ．ホフマン−ラ ロシュ アーゲー Combination therapy with type I and type II anti-CD20 antibodies
CN101821292B (en) * 2007-09-05 2014-03-26 霍夫曼-拉罗奇有限公司 Combination therapy with type I and type II anti-cd20 antibodies
WO2009030368A1 (en) 2007-09-05 2009-03-12 F. Hoffmann-La Roche Ag Combination therapy with type i and type ii anti-cd20 antibodies
EP2604277A1 (en) 2007-10-15 2013-06-19 Roche Glycart AG Combination therapy of a type II anti-CD20 antibody with an anti-Bcl-2 active agent
JP2011500741A (en) * 2007-10-24 2011-01-06 ロシュ グリクアート アクチェンゲゼルシャフト Combination therapy of type II anti-CD20 antibody and proteasome inhibitor
US9266967B2 (en) 2007-12-21 2016-02-23 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
WO2009086072A3 (en) * 2007-12-21 2009-11-05 Genentech, Inc. Therapy of rituximab-refractory rheumatoid arthritis patients
US10138293B2 (en) 2007-12-21 2018-11-27 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
US10927163B2 (en) 2007-12-21 2021-02-23 Hoffmann-La Roche, Inc. Bivalent, bispecific antibodies
RU2589704C2 (en) * 2008-03-25 2016-07-10 Роше Гликарт Аг Using anti-cd20 type ii antibody, having high antibody-induced cell-dependent cytotoxicity (adcc), combined with cyclophosphamide, vincristine and doxorubicin for treating non-hodgkin lymphomas
TWI500624B (en) * 2008-03-25 2015-09-21 Hoffmann La Roche Combination therapy of a type ii anti-cd20 antibody with increased antibody dependent cellular cytotoxicity (adcc)
JP2014101370A (en) * 2008-03-25 2014-06-05 Roche Glycart Ag Use of type ii anti-cd20 antibody with increased antibody dependent cellular cytotoxicity (adcc) in combination with cyclophosphamide, vincristine and doxorubicine for treatment of non-hodgkin's lymphomas
JP2011515428A (en) * 2008-03-25 2011-05-19 ロシュ グリクアート アクチェンゲゼルシャフト Use of a type II anti-CD20 antibody with increased antibody-dependent cellular cytotoxicity (ADCC) in combination with cyclophosphamide, vincristine and doxorubicin for the treatment of non-Hodgkin lymphoma
WO2009118142A1 (en) * 2008-03-25 2009-10-01 F. Hoffmann-La Roche Ag Use of a type ii anti-cd20 antibody with increased antibody dependent cellular cytotoxicity (adcc) in combination with cyclophosphamide, vincristine and doxorubicine for treating non-hodgkin' s lymphomas
CN107198772A (en) * 2008-03-25 2017-09-26 罗氏格黎卡特股份公司 The application of II types anti-CD 20 antibodies and endoxan, vincristine and Doxorubicin therapeutic alliance NHL
WO2010115554A1 (en) 2009-03-31 2010-10-14 Roche Glycart Ag Combination therapy of an afucosylated antibody and one or more of the cytokines selected from human gm-csf, human m-csf and/or human il-3
US9382323B2 (en) 2009-04-02 2016-07-05 Roche Glycart Ag Multispecific antibodies comprising full length antibodies and single chain fab fragments
WO2010115551A1 (en) 2009-04-07 2010-10-14 Roche Glycart Ag Bispecific anti-erbb-1/anti-c-met antibodies
US9890204B2 (en) 2009-04-07 2018-02-13 Hoffmann-La Roche Inc. Trivalent, bispecific antibodies
WO2010115552A1 (en) 2009-04-07 2010-10-14 Roche Glycart Ag Bispecific anti-erbb-3/anti-c-met antibodies
WO2010115553A1 (en) 2009-04-07 2010-10-14 Roche Glycart Ag Bispecific anti-erbb-2/anti-c-met antibodies
US11673945B2 (en) 2009-06-16 2023-06-13 Hoffmann-La Roche Inc. Bispecific antigen binding proteins
US9676845B2 (en) 2009-06-16 2017-06-13 Hoffmann-La Roche, Inc. Bispecific antigen binding proteins
US10640555B2 (en) 2009-06-16 2020-05-05 Hoffmann-La Roche Inc. Bispecific antigen binding proteins
US20150093376A1 (en) * 2009-08-14 2015-04-02 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with bendamustine
US20110165152A1 (en) * 2009-08-14 2011-07-07 Martin Dreyling Combination therapy of an afucosylated cd20 antibody with fludarabine and/or mitoxantrone
WO2011018224A1 (en) 2009-08-14 2011-02-17 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with bendamustine
WO2011018225A1 (en) 2009-08-14 2011-02-17 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with fludarabine and/or mitoxantrone
US20150079073A1 (en) * 2009-08-14 2015-03-19 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with fludarabine and/or mitoxantrone
WO2011023390A1 (en) 2009-08-28 2011-03-03 F. Hoffmann-La Roche Ag Antibodies against cdcp1 for the treatment of cancer
WO2011023389A1 (en) 2009-08-28 2011-03-03 Roche Glycart Ag Humanized anti-cdcp1 antibodies
US10752696B2 (en) 2009-09-11 2020-08-25 Genentech, Inc. Highly concentrated pharmaceutical formulations
US10377831B2 (en) 2009-09-11 2019-08-13 Genentech, Inc. Highly concentrated pharmaceutical formulations
US10280227B2 (en) 2009-09-11 2019-05-07 Genentech, Inc. Highly concentrated pharmaceutical formulations
US9994646B2 (en) 2009-09-16 2018-06-12 Genentech, Inc. Coiled coil and/or tether containing protein complexes and uses thereof
WO2011076683A1 (en) 2009-12-22 2011-06-30 Roche Glycart Ag Anti-her3 antibodies and uses thereof
WO2011117330A1 (en) 2010-03-26 2011-09-29 Roche Glycart Ag Bispecific antibodies
US10106600B2 (en) 2010-03-26 2018-10-23 Roche Glycart Ag Bispecific antibodies
WO2011134899A1 (en) 2010-04-27 2011-11-03 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with a mtor inhibitor
WO2012018771A1 (en) 2010-08-03 2012-02-09 Genentech, Inc. Chronic lymphocytic leukemia (cll) biomarkers
KR101522113B1 (en) 2010-08-17 2015-05-20 로슈 글리카트 아게 Combination therapy of an afucosylated cd20 antibody with an anti-vegf antibody
WO2012022747A1 (en) 2010-08-17 2012-02-23 F. Hoffmann-La Roche Ag Combination therapy of an afucosylated cd20 antibody with an anti-vegf antibody
US20160017050A1 (en) * 2010-08-17 2016-01-21 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with an anti-vegf
US20140322200A1 (en) * 2010-08-17 2014-10-30 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with an anti-vegf antibody
US9879095B2 (en) 2010-08-24 2018-01-30 Hoffman-La Roche Inc. Bispecific antibodies comprising a disulfide stabilized-Fv fragment
WO2012025530A1 (en) 2010-08-24 2012-03-01 F. Hoffmann-La Roche Ag Bispecific antibodies comprising a disulfide stabilized - fv fragment
US9085622B2 (en) 2010-09-03 2015-07-21 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins
WO2012080389A1 (en) 2010-12-16 2012-06-21 Roche Glycart Ag Combination therapy of an afucosylated cd20 antibody with a mdm2 inhibitor
US11618790B2 (en) 2010-12-23 2023-04-04 Hoffmann-La Roche Inc. Polypeptide-polynucleotide-complex and its use in targeted effector moiety delivery
US9982036B2 (en) 2011-02-28 2018-05-29 Hoffmann-La Roche Inc. Dual FC antigen binding proteins
WO2012116926A1 (en) 2011-02-28 2012-09-07 F. Hoffmann-La Roche Ag Antigen binding proteins
WO2012116927A1 (en) 2011-02-28 2012-09-07 F. Hoffmann-La Roche Ag Monovalent antigen binding proteins
US10793621B2 (en) 2011-02-28 2020-10-06 Hoffmann-La Roche Inc. Nucleic acid encoding dual Fc antigen binding proteins
US10611825B2 (en) 2011-02-28 2020-04-07 Hoffmann La-Roche Inc. Monovalent antigen binding proteins
WO2013041462A1 (en) 2011-09-23 2013-03-28 Roche Glycart Ag Bispecific anti-egfr/anti igf-1r antibodies
WO2013076183A1 (en) 2011-11-25 2013-05-30 Roche Glycart Ag Combination therapy using anti - cd20 antibody and human il-15
CN104136043A (en) * 2011-11-25 2014-11-05 罗切格利卡特公司 Combination therapy using anti - CD20 antibody and human IL-15
JP2014534250A (en) * 2011-11-25 2014-12-18 ロシュ グリクアート アーゲー Combination therapy using anti-CD20 antibody and human IL-15
US9688758B2 (en) 2012-02-10 2017-06-27 Genentech, Inc. Single-chain antibodies and other heteromultimers
US11421022B2 (en) 2012-06-27 2022-08-23 Hoffmann-La Roche Inc. Method for making antibody Fc-region conjugates comprising at least one binding entity that specifically binds to a target and uses thereof
US11407836B2 (en) 2012-06-27 2022-08-09 Hoffmann-La Roche Inc. Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof
US10106612B2 (en) 2012-06-27 2018-10-23 Hoffmann-La Roche Inc. Method for selection and production of tailor-made highly selective and multi-specific targeting entities containing at least two different binding entities and uses thereof
EP2727941A1 (en) 2012-11-05 2014-05-07 MAB Discovery GmbH Method for the production of multispecific antibodies
EP2727943A1 (en) 2012-11-05 2014-05-07 MAB Discovery GmbH Trispecific antibodies against human EGFR, HER2 and HER3
EP2727942A1 (en) 2012-11-05 2014-05-07 MAB Discovery GmbH Bispecific antibodies against human EGFR, HER2, and HER3
WO2014067642A1 (en) 2012-11-05 2014-05-08 Mab Discovery Gmbh Method for the production of multispecific antibodies
WO2014108484A2 (en) 2013-01-11 2014-07-17 F. Hoffmann-La Roche Ag Combination therapy of anti-her3 antibodies
US9963513B2 (en) 2013-02-05 2018-05-08 Engmab Sàrl Method for the selection of antibodies against BCMA
US10851171B2 (en) 2013-02-05 2020-12-01 Engmab Sarl Method for the selection of antibodies against BCMA
EP2762496A1 (en) 2013-02-05 2014-08-06 EngMab AG Method for the selection of antibodies against BCMA
EP3620468A1 (en) 2013-02-05 2020-03-11 EngMab Sàrl Method for the selection of antibodies against bcma
US10077315B2 (en) 2013-02-05 2018-09-18 Engmab Sàrl Bispecific antibodies against CD3 and BCMA
WO2014122143A1 (en) 2013-02-05 2014-08-14 Engmab Ag Method for the selection of antibodies against bcma
US10010611B2 (en) 2013-03-13 2018-07-03 Genentech, Inc. Antibody formulations
US10925966B2 (en) 2013-03-13 2021-02-23 Genentech, Inc. Antibody formulations
EP3744345A1 (en) 2013-03-13 2020-12-02 F. Hoffmann-La Roche AG Antibody formulations
WO2014160490A1 (en) 2013-03-13 2014-10-02 Genetech, Inc. Antibody formulations
US10323099B2 (en) 2013-10-11 2019-06-18 Hoffmann-La Roche Inc. Multispecific domain exchanged common variable light chain antibodies
WO2015082446A1 (en) 2013-12-02 2015-06-11 F. Hoffmann-La Roche Ag Treatment of cancer using an anti-cdcp1 antibody and a taxane
WO2015095410A1 (en) 2013-12-17 2015-06-25 Genentech, Inc. Methods of treating cancer using pd-1 axis binding antagonists and an anti-cd20 antibody
EP3613433A1 (en) 2014-05-30 2020-02-26 Henlix Biotech Co., Ltd. Anti-epidermal growth factor receptor (egfr) antibodies
US10584171B2 (en) 2014-05-30 2020-03-10 Henlix Biotech Co., Ltd. Anti-epidermal growth factor receptor (EGFR) antibodies
US11261255B2 (en) 2014-05-30 2022-03-01 Shanghai Henlius Biotech, Inc. Anti-epidermal growth factor receptor (EGFR) antibodies
US11370833B2 (en) 2014-09-15 2022-06-28 Genentech, Inc. Antibody formulations
EP3689910A2 (en) 2014-09-23 2020-08-05 F. Hoffmann-La Roche AG Method of using anti-cd79b immunoconjugates
US10633457B2 (en) 2014-12-03 2020-04-28 Hoffmann-La Roche Inc. Multispecific antibodies
EP4238994A2 (en) 2015-05-11 2023-09-06 F. Hoffmann-La Roche AG Compositions and methods of treating lupus nephritis
EP4238994A3 (en) * 2015-05-11 2024-02-07 F. Hoffmann-La Roche AG Compositions and methods of treating lupus nephritis
EP3936524A2 (en) 2015-05-11 2022-01-12 F. Hoffmann-La Roche AG Compositions and methods of treating lupus nephritis
EP3936524A3 (en) * 2015-05-11 2022-06-15 F. Hoffmann-La Roche AG Compositions and methods of treating lupus nephritis
WO2016183104A1 (en) * 2015-05-11 2016-11-17 Genentech, Inc. Compositions and methods of treating lupus nephritis
EP3108897A1 (en) 2015-06-24 2016-12-28 F. Hoffmann-La Roche AG Antibodies against human csf-1r for use in inducing lymphocytosis in lymphomas or leukemias
US11198728B2 (en) 2015-06-26 2021-12-14 Sanofi Biotechnology SAS Monoclonal anti-IL-1RAcp antibodies
WO2016207304A2 (en) 2015-06-26 2016-12-29 Mab Discovery Gmbh Monoclonal anti-il-1racp antibodies
US10906971B2 (en) 2015-06-26 2021-02-02 Sanofi Biotechnology SAS Monoclonal anti-IL-1RAcP antibodies
WO2017004091A1 (en) 2015-06-29 2017-01-05 Genentech, Inc. Type ii anti-cd20 antibody for use in organ transplantation
EP3670535A1 (en) 2015-08-03 2020-06-24 EngMab Sàrl Monoclonal antibodies against bcma
US11286300B2 (en) 2015-10-01 2022-03-29 Hoffmann-La Roche Inc. Humanized anti-human CD19 antibodies and methods of use
EP3178848A1 (en) 2015-12-09 2017-06-14 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody for reducing formation of anti-drug antibodies
EP4026848A1 (en) 2015-12-09 2022-07-13 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody for reducing the cytokine release syndrome
WO2017148879A1 (en) 2016-03-01 2017-09-08 F. Hoffmann-La Roche Ag Obinutuzumab and rituximab variants having reduced adcp
WO2017148880A1 (en) 2016-03-01 2017-09-08 F. Hoffmann-La Roche Ag Obinutuzumab variants having altered cell death induction
US11525007B2 (en) 2016-03-01 2022-12-13 Hoffmann-La Roche Inc. Antibody fab and Fc variants
US11203642B2 (en) 2016-05-06 2021-12-21 Sanofi Biotechnology SAS Humanized anti-IL-1R3 antibodies
EP3252078A1 (en) 2016-06-02 2017-12-06 F. Hoffmann-La Roche AG Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
EP3257866A1 (en) 2016-06-17 2017-12-20 Academisch Medisch Centrum Modified anti-tnf antibody and use thereof in the treatment of ibd
US11124577B2 (en) 2016-11-02 2021-09-21 Engmab Sàrl Bispecific antibody against BCMA and CD3 and an immunological drug for combined use in treating multiple myeloma
WO2018083204A1 (en) 2016-11-02 2018-05-11 Engmab Sàrl Bispecific antibody against bcma and cd3 and an immunological drug for combined use in treating multiple myeloma
EP4295918A2 (en) 2016-11-02 2023-12-27 Bristol-Myers Squibb Company Bispecific antibody against bcma and cd3 and an immunological drug for combined use in treating multiple myeloma
WO2018114748A1 (en) 2016-12-20 2018-06-28 F. Hoffmann-La Roche Ag Combination therapy of anti-cd20/anti-cd3 bispecific antibodies and 4-1bb (cd137) agonists
US11718680B2 (en) 2016-12-20 2023-08-08 Hoffmann-La Roche Inc. Combination therapy of anti-CD20/anti-CD3 bispecific antibodies and 4-1BB (CD137) agonists
US11639392B2 (en) 2017-05-08 2023-05-02 Sanofi Biotechnology Anti-IL-1R3 antibodies for use in inflammatory conditions
WO2018220099A1 (en) 2017-06-02 2018-12-06 F. Hoffmann-La Roche Ag Type ii anti-cd20 antibody and anti-cd20/cd3 bispecific antibody for treatment of cancer
WO2019020606A1 (en) 2017-07-26 2019-01-31 F. Hoffmann-La Roche Ag Combination therapy with a bet inhibitor, a bcl-2 inhibitor and an anti-cd20 antibody
US11859003B2 (en) 2017-08-21 2024-01-02 Adagene Inc. Method for treating cancer using anti-CD137 antibody
US11952681B2 (en) 2018-02-02 2024-04-09 Adagene Inc. Masked activatable CD137 antibodies
WO2019175071A1 (en) 2018-03-13 2019-09-19 F. Hoffmann-La Roche Ag Therapeutic combination of 4-1 bb agonists with anti-cd20 antibodies
WO2020117257A1 (en) 2018-12-06 2020-06-11 Genentech, Inc. Combination therapy of diffuse large b-cell lymphoma comprising an anti-cd79b immunoconjugates, an alkylating agent and an anti-cd20 antibody
WO2020232169A1 (en) 2019-05-14 2020-11-19 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat follicular lymphoma
WO2021050645A1 (en) 2019-09-12 2021-03-18 Genentech, Inc. Compositions and methods of treating lupus nephritis
WO2021076196A1 (en) 2019-10-18 2021-04-22 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma
WO2021217051A1 (en) 2020-04-24 2021-10-28 Genentech, Inc. Methods of using anti-cd79b immunoconjugates
WO2022148732A1 (en) 2021-01-06 2022-07-14 F. Hoffmann-La Roche Ag Combination therapy employing a pd1-lag3 bispecific antibody and a cd20 t cell bispecific antibody
WO2022198192A1 (en) 2021-03-15 2022-09-22 Genentech, Inc. Compositions and methods of treating lupus nephritis
WO2022241446A1 (en) 2021-05-12 2022-11-17 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma
WO2023019092A1 (en) 2021-08-07 2023-02-16 Genentech, Inc. Methods of using anti-cd79b immunoconjugates to treat diffuse large b-cell lymphoma

Also Published As

Publication number Publication date
JP2013116120A (en) 2013-06-13
RU2008111068A (en) 2009-10-10
EP2395024B1 (en) 2018-12-19
IL189756A (en) 2017-08-31
AU2006290433B2 (en) 2012-06-07
WO2007031875A3 (en) 2008-02-14
EP2395024A2 (en) 2011-12-14
EP1931712B1 (en) 2018-12-05
EP2395023A2 (en) 2011-12-14
CL2010000822A1 (en) 2011-01-07
JP5373396B2 (en) 2013-12-18
TWI615407B (en) 2018-02-21
RU2547931C2 (en) 2015-04-10
CN103204935B (en) 2014-12-10
CN101291954B (en) 2013-03-27
RU2482132C2 (en) 2013-05-20
CN103204935A (en) 2013-07-17
CA2619298C (en) 2017-07-04
JP5912090B2 (en) 2016-04-27
NO20210557A1 (en) 2008-05-23
EP2395023A3 (en) 2012-02-01
KR20080040036A (en) 2008-05-07
PH12012502376A1 (en) 2016-01-11
TWI478940B (en) 2015-04-01
US20070071745A1 (en) 2007-03-29
CN101291954A (en) 2008-10-22
CL2010000823A1 (en) 2011-01-07
HK1185357A1 (en) 2014-02-14
EP2395024A3 (en) 2012-02-22
SG192479A1 (en) 2013-08-30
US20150344584A1 (en) 2015-12-03
AR055137A1 (en) 2007-08-08
PH12012502376B1 (en) 2016-01-11
KR101460932B1 (en) 2014-11-12
NO20081328L (en) 2008-05-23
BRPI0615397A2 (en) 2011-05-17
TW201527324A (en) 2015-07-16
EP2395023B1 (en) 2019-04-03
JP2015078191A (en) 2015-04-23
KR20130119988A (en) 2013-11-01
RU2012139197A (en) 2014-03-20
ZA200802500B (en) 2023-04-26
BRPI0615397B1 (en) 2023-10-03
JP2009505650A (en) 2009-02-12
AU2006290433A1 (en) 2007-03-22
JP6081974B2 (en) 2017-02-15
NO345919B1 (en) 2021-10-18
BR122020020335B1 (en) 2023-10-03
TW200804423A (en) 2008-01-16
EP1931712A2 (en) 2008-06-18
CA2619298A1 (en) 2007-03-22
KR101379568B1 (en) 2014-04-08

Similar Documents

Publication Publication Date Title
EP1931712B1 (en) Modified antigen binding molecules with altered cell signaling activity
US20230212303A1 (en) Antigen binding molecules with increased fc receptor binding affinity and effector function
AU2012216702B2 (en) Modified antigen binding molecules with altered cell signaling activity

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200680038849.1

Country of ref document: CN

DPE2 Request for preliminary examination filed before expiration of 19th month from priority date (pct application filed from 20040101)
WWE Wipo information: entry into national phase

Ref document number: 2619298

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/a/2008/002577

Country of ref document: MX

Ref document number: 12008500466

Country of ref document: PH

WWE Wipo information: entry into national phase

Ref document number: 2008527537

Country of ref document: JP

Ref document number: 189756

Country of ref document: IL

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2006290433

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2006831581

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2008111068

Country of ref document: RU

Ref document number: 1484/CHENP/2008

Country of ref document: IN

Ref document number: 1020087007364

Country of ref document: KR

ENP Entry into the national phase

Ref document number: 2006290433

Country of ref document: AU

Date of ref document: 20060825

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2006290433

Country of ref document: AU

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 06831581

Country of ref document: EP

Kind code of ref document: A2

WWP Wipo information: published in national office

Ref document number: 2006831581

Country of ref document: EP

ENP Entry into the national phase

Ref document number: PI0615397

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20080227